KEGG   Roseobacter litoralis: RLO149_c004660Help
Entry
RLO149_c004660    CDS       T01572                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase FadA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rli  Roseobacter litoralis
Pathway
rli00071  Fatty acid degradation
rli00072  Synthesis and degradation of ketone bodies
rli00280  Valine, leucine and isoleucine degradation
rli00310  Lysine degradation
rli00362  Benzoate degradation
rli00380  Tryptophan metabolism
rli00620  Pyruvate metabolism
rli00630  Glyoxylate and dicarboxylate metabolism
rli00640  Propanoate metabolism
rli00650  Butanoate metabolism
rli00900  Terpenoid backbone biosynthesis
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01200  Carbon metabolism
rli01212  Fatty acid metabolism
rli02020  Two-component system
Module
rli_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLO149_c004660 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RLO149_c004660 (fadA)
   00640 Propanoate metabolism
    RLO149_c004660 (fadA)
   00650 Butanoate metabolism
    RLO149_c004660 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RLO149_c004660 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RLO149_c004660 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLO149_c004660 (fadA)
   00310 Lysine degradation
    RLO149_c004660 (fadA)
   00380 Tryptophan metabolism
    RLO149_c004660 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RLO149_c004660 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RLO149_c004660 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RLO149_c004660 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rli04147]
    RLO149_c004660 (fadA)
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RLO149_c004660 (fadA)
Exosome [BR:rli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RLO149_c004660 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEI92494
UniProt: F7ZIH5
Position
complement(495195..496406)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDALRTPRGKGRKDGSLHEVTSLRLSAQTLNALKERNNLEGHAVEDVIWGNVTQ
VMEQGGCLARSAVLASDLDERIPGLAINRFCASGMEAVNLAANQVRGGAGQAYIAGGVEM
MGRVAMGSDGAAIAVDPTLAMEKYFVPQGISADIIATEYGFGRDDADTLAVESQRRAKQA
WDEGRFDKSVIEVRDQNGLKILDHDEYMRPQTDMQSLGALNPAFQAMGEVMPGFDKVALM
KYPHLERINHIHHAGNSSGIVDGAAAVLIGNKEFGEEHGLKPRARIRATAKIGTDPTIML
TGPVPVTEKILADSGMNIKDIDLFEVNEAFAAVVLRFMQAFDVDDAKVNVNGGSIAMGHP
LGATGAIIIGTLLDELERADKEVGLATLCIASGMGAATIIERM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgacgcgctacgcaccccgcgtggcaagggccgcaaagac
ggcagcctgcatgaggtgacatccctgcgcctgtccgcacagacgctcaacgcgctgaag
gaacgtaacaaccttgagggtcacgccgtagaagatgtgatctggggaaatgtgacacag
gtgatggaacagggcggctgccttgcgcgctctgcggtgttggcctccgatctggatgag
cgcatcccagggctggccatcaaccggttttgcgcctccggcatggaggcggtcaacctc
gccgccaatcaggtgcgcggcggtgccggtcaggcctatatcgcgggcggtgtcgaaatg
atgggccgtgtggccatgggcagtgacggggcggccatcgcggttgatccgacgctcgcg
atggagaaatacttcgtcccccaaggcatcagcgcggatatcatcgcgaccgaatatggc
ttcggccgcgatgatgcggacacgttggcggtcgaatcccagcgtcgtgcaaaacaggca
tgggatgaggggcgttttgacaaatccgtcatcgaggtgcgcgaccagaacgggctgaag
attctggatcacgacgaatacatgcgcccgcaaaccgacatgcaaagccttggcgcgctg
aaccccgcctttcaggcgatgggagaggtcatgcccggcttcgacaaggtcgcgctgatg
aaatatccgcatcttgagcggatcaaccacatccatcacgcgggcaactcatcgggtatc
gtcgatggggctgcggccgttctgatcggcaacaaggagttcggcgaagagcacgggctg
aagccgcgcgcccgcatccgcgccacggcgaaaatcgggaccgaccccacgatcatgctg
accggtcctgtgccggtgaccgaaaaaatccttgccgacagtggcatgaacatcaaggac
attgatctttttgaggtgaacgaggcctttgctgccgtcgtgctgcgcttcatgcaggcg
tttgatgtcgatgatgcgaaagtaaacgtcaacggcggctcgatcgcaatgggccatccg
ctgggggcaaccggggccatcatcatcggcacgctgctggatgagttggagcgcgccgac
aaagaggtcggccttgccacgctctgcatcgcctccggcatgggtgccgcgaccattatt
gagcggatgtaa

DBGET integrated database retrieval system