KEGG   Roseobacter litoralis: RLO149_c010420Help
Entry
RLO149_c010420    CDS       T01572                                 

Definition
(GenBank) hypothetical protein
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
rli  Roseobacter litoralis
Pathway
rli00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rli00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RLO149_c010420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rli01007]
    RLO149_c010420
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rli03016]
    RLO149_c010420
Enzymes [BR:rli01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     RLO149_c010420
Amino acid related enzymes [BR:rli01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   RLO149_c010420
Transfer RNA biogenesis [BR:rli03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RLO149_c010420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AEI93051
UniProt: F7ZB58
Position
1085152..1087380
Genome map
AA seq 742 aa AA seqDB search
MPDLLIELFSEEIPARMQRHAAQDLQKLVADGLVEAGLTYASAAAFSTPRRLTLTLEGVL
AASPTTVEERKGPKADAPDKAIEGFLRGAGVTREALETRDTPKGPVLFAKITKEGRPAAQ
IVAEVLEKTIRNFPWPKSMRWGTGTLRWVRPLHSILCILSDEAGTQVVPLSVDLITAGDS
TQGHRFMAPDRFSVTGFDDYTAKLKRAFVVLDPAERADMIWHDATNQAFANGLEVVEDAG
LLAEVAGLVEWPVVLMGRIDEAFLDLPPEVLQTSMKEHQKFFSVRNPKTGRIERFVTVAN
RDTADNGATILAGNEKVLSARLADAKFFWDNDLRVAKAGMGEWLKALENVTFHNKLGTQA
ELVDRVAALAREMAPMVGADPDEAEEAARLAKADLSSEMVYEFPELQGLMGRYYLKAAGK
SDAIAAAAQEHYAPLGPSDAVPTAPVSVAVALAEKIDKLTGFWAIDEKPTGSKDPFALRR
AALGVVRLALGNGVRIDLERLLKLLVAEQLIGIARIKFEDEFEPVPIEERGRYYQGVLEF
WRALEEFESLETKLRTSPDDEPLIIQGARSLLTFLHDRLKVYLRDQGIRHDVIDACIAMP
GNDDLTLLVKRAKALSDVVGTEDGENLIQGFKRANNILTQAQEADGVEYSYGADIKFAET
DEERALFEALDTAEAIITPAMKSEDFATAMSAMATLRAPIDAFFEAVQVNSDNPTVRRNR
LNLLSRITQICLSVADLTRIEG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatctactgattgaactcttctccgaagaaatccccgcccgcatgcagcgccac
gcggcacaagacctgcagaaactcgtcgctgatggtctggttgaagccgggttaacctat
gcctctgcggcggcgttctccacaccgcgccgtctgaccctgacgcttgagggggtgctt
gcggcaagccccaccactgtcgaggagcgcaaaggcccgaaagccgatgcgcctgacaag
gccattgagggtttcctgcgcggtgcaggtgtcacgcgcgaggcactcgagacgcgggat
acgcccaaagggccggtgctttttgcgaaaatcaccaaagagggacggcccgccgcgcag
atcgtggcggaagttctggaaaagacgatccgtaactttccatggcccaaatccatgcgc
tggggcacgggcaccctgcgctgggtgcgcccgttacactcgatcctatgcattctgtcg
gatgaggcaggcacgcaggtcgtaccgctgagcgtcgatctcatcacggcgggggacagc
acacaggggcatcgtttcatggcgccggaccggttctcggtcactgggtttgatgactat
acggccaagctgaaacgcgcctttgtcgtgctcgacccggcagagcgggcagatatgatc
tggcacgatgccaccaatcaggcctttgccaatgggcttgaggtggtcgaggatgcgggt
ctgctggccgaggtcgcagggctggtcgaatggcctgtagttctgatggggcggattgac
gaagccttcctcgatctgccgccggaggttctgcaaacctcgatgaaagagcatcagaaa
ttcttctccgtgcgtaatcccaagacaggccggatcgagcggttcgtcaccgtggccaac
cgcgacacggcggataacggcgcgaccattctggcggggaatgaaaaggtgctatcggcg
cgtttggcggatgcgaaattcttttgggacaatgatttgcgtgtggccaaagcgggcatg
ggcgagtggctgaaagccttggaaaatgtgacctttcacaacaagcttggcacgcaggcc
gaactggtggaccgggtcgcggcgctggcgcgcgaaatggccccgatggtgggggccgac
ccagatgaggcggaagaggctgcgcgtctggccaaggcggatttatcgtctgagatggtc
tacgaattccccgaactgcaggggctgatggggcgctattacctgaaagccgccgggaag
tccgacgccatcgcggcggcggcacaagaacactacgcgccccttgggccgtccgacgcc
gtgcccaccgcgcccgtatcggtcgctgtggcactggccgaaaagatcgacaaactgacg
ggtttctgggcgattgacgagaagccgaccgggtcaaaagatccctttgcgctgcgtcgg
gcggcgctgggggttgttcggttggccttgggaaatggggttcgcatcgacctagagcgg
cttttgaagttgctggtcgcagaacagctgattggtattgcaagaattaagtttgaggac
gaattcgaaccggtgccgatcgaagagcgcggaagatattatcagggcgtactcgaattt
tggagagcacttgaggaattcgagagtttggagactaagcttcggacatctcctgacgat
gaacctttgatcatccaaggcgctagaagccttctcaccttcctccacgaccgcctcaaa
gtctatctccgcgatcaaggcatccgccacgacgtgatcgacgcttgcatcgccatgccg
ggcaatgatgacctcacgttgctcgtcaaacgggccaaggcgttgtccgatgtggtcggc
accgaggatggagaaaacctgatccagggcttcaagcgggccaacaacatcctgacgcag
gcgcaggaggcggatggggtcgagtactcctacggcgcggatatcaaattcgcggaaacc
gacgaagaacgcgcgctgttcgaagcgctggacaccgctgaggcgatcatcaccccggcg
atgaaatccgaagactttgccaccgccatgtccgccatggccacactgcgcgcgccgatt
gatgcgttttttgaggcggtgcaggtcaattctgacaacccgactgtccggcgcaacagg
ctcaacctgctcagccggatcacgcagatctgtctgtctgtcgcggacctgacccggatc
gagggctaa

DBGET integrated database retrieval system