KEGG   Roseobacter litoralis: RLO149_c012780Help
Entry
RLO149_c012780    CDS       T01572                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rli  Roseobacter litoralis
Pathway
rli00260  Glycine, serine and threonine metabolism
rli00750  Vitamin B6 metabolism
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RLO149_c012780 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RLO149_c012780 (thrC)
Enzymes [BR:rli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RLO149_c012780 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEI93280
UniProt: F7ZD71
Position
1314280..1315662
Genome map
AA seq 460 aa AA seqDB search
MQYISTRGTAPVLNFEEAMLSGLARDGGLYVPKTIPQLSPDTISAMEGQRYEDIAYTVMR
PFVGDVFTDTEFREIIGRAYAVFGHDARAPLKQLDQGHFLLELFHGPTLAFKDFAMQLIG
QMFQTALGRKNERVTIVGATSGDTGSAAIEAFRGLSNVDVFIMYPHGRISEVQRRQMTTP
TESNVHALAVDGDFDDCQARLKDMFNDFDFRDTVRLAGVNSINWGRVLAQVVYYFSAAVA
LGAPHRKVSFTVPTGNFGDVFAGYIAKQMGLPIDRLVVATNQNDILHRCLNGQGYHKGET
VPSISPSMDIQVSSNFERALFDAYDREGPAIVQLMDELKAGGFDVSQGAMQVLQSHYTSG
RASEQETSDTIARALKHSGELLCPHSAIGVKVADEERVIGTPMVTLATAHPAKFPAAVEA
ASGIHPPLPARMSDLYERSERVTRVPNDLDALKKHIKGHI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacatctcgacccgtggcaccgcgcctgtgctgaattttgaagaggcgatgttg
agcgggcttgcccgtgatggcggtctgtatgtccccaaaacaatcccacagctgtcgccc
gataccatcagcgcgatggaaggccagcgctatgaagacatcgcctacaccgtaatgcgc
ccctttgtaggggatgttttcacggacacggaatttcgcgagatcatcgggcgtgcctat
gcggtctttggccatgacgcgcgcgccccgctcaagcagttggatcaggggcattttctg
ctggagctgtttcatgggcctacgctggccttcaaggactttgccatgcagctgatcggg
cagatgttccaaacagcattggggcgcaagaacgaacgcgtgacgattgtgggggccaca
tccggtgacaccggttctgccgcgattgaagcatttcggggcctgagcaatgtggatgtg
ttcatcatgtatccccatggccgcatttctgaagtgcagcgccgccagatgaccacgccg
accgaaagcaatgtgcatgctttggccgtggatggtgactttgacgactgtcaggcgcgg
ctcaaggatatgttcaacgatttcgacttccgcgataccgtgcgccttgctggggtgaac
tcgatcaactggggccgcgtgctggcgcaggtggtctattatttttcggcagccgtcgca
ttgggcgcaccacaccgcaaggtcagctttacagtgcccaccggcaattttggagacgtt
ttcgcaggctatatcgccaagcagatgggcctgccaattgaccggctggtggtggccacc
aaccagaacgacatcctgcaccgctgtctgaacgggcagggctatcacaagggggaaaca
gtgccctcgatcagcccgtcgatggatattcaggtcagctcaaattttgaacgcgcatta
tttgacgcctatgaccgcgaaggaccggccatcgttcagttgatggacgaactgaaagcc
ggtgggtttgacgtaagccaaggcgcgatgcaggtcctgcagtcgcattacacgtcgggg
cgtgcctctgaacaggaaacgtcggatactattgcgcgcgcgctgaaacacagcggcgag
ttgctgtgcccgcattcggccattggcgtcaaagtcgccgatgaggaacgcgtcatcggc
acgcccatggtcacgctggcgaccgcccacccggctaaattcccggcagccgtcgaggcg
gcatcgggcatacatccacccttgcctgcacgtatgtctgacctgtatgagcgcagcgaa
agggtgacccgcgtgccaaacgatctggacgccctgaaaaaacatataaaagggcacatc
tga

DBGET integrated database retrieval system