KEGG   Roseobacter litoralis: RLO149_c027270Help
Entry
RLO149_c027270    CDS       T01572                                 

Gene name
ltaE2
Definition
(GenBank) low specificity L-threonine aldolase ItaE
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rli  Roseobacter litoralis
Pathway
rli00260  Glycine, serine and threonine metabolism
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RLO149_c027270 (ltaE2)
Enzymes [BR:rli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RLO149_c027270 (ltaE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Pyridoxal_deC ELFV_dehydrog_N GSDH
Motif
Other DBs
NCBI-ProteinID: AEI94689
UniProt: F7ZF66
Position
2783808..2784845
Genome map
AA seq 345 aa AA seqDB search
MYLASDNTGPAHPQVMEHVLAANEGYAMPYGADPIMERVRDRVRDVFEAPDAAVYLVATG
TAANALALACYGQPWQTVFCSPVAHIHEDECNAPEFYSAGSKLTLVPGSDRMTPDALRSS
IETEESRGVHGPQRGPVSITQVTERGGVYTLDEISALTDIAKHYGLPVHLDGARFANAMV
ALECSAAEMTWKRGVDVVSFGGTKNGCMGVEAVVFFDPDKAWEFELRRKRGAHLFSKHRF
LSAQMEGYLKNDIWLDMARQSNARAAQLSAGLVEKGAHLLHAPDANMIFASFPRRIHQRL
HDAGAKYYIWSGNLEGDDPDALLAARLVCDWSLSEEHIAEFLSHF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcgcctctgacaacaccggccccgcacacccgcaggtgatggaacatgtgctg
gccgccaatgaaggttacgccatgccctacggcgcggacccgatcatggaacgcgtgcgc
gacagggtgcgcgatgtctttgaagcgccggatgctgcggtctatctggtcgccactggc
acggcagccaatgcgctggcgctggcgtgctatggtcagccgtggcagacggttttctgc
tcaccggtggcgcatatccacgaggatgaatgcaacgcgcctgaattttacagcgcgggc
agcaaactcacgctcgtgcccggttcggacaggatgacaccggatgcgctgcgctcatca
atcgaaacggaggaaagccgcggcgtgcacgggccacagcgcggtcccgtctcgatcaca
caggtcacggaacgcggcggtgtctacacccttgatgagattagcgccctcacggatatt
gcaaaacactatggtctgcccgtgcatctggacggcgcacggtttgcaaatgccatggtg
gcgctggaatgttcagctgctgaaatgacgtggaaacgcggcgtcgatgttgtcagcttt
ggaggtacgaaaaacggctgtatgggggtggaggccgttgttttctttgaccctgacaaa
gcctgggaattcgaattgcgccgaaaacggggtgcgcatcttttctcaaaacaccgcttt
ttatctgctcagatggaggggtatctgaaaaacgatatctggctggatatggcgcgccaa
tccaatgcgcgcgccgcacagctcagcgcggggttggtggaaaaaggcgcgcatttactc
catgcgcctgacgccaatatgattttcgcaagctttccgcgccggatacaccagcgcctg
catgacgcgggcgcgaagtattacatctggtccggaaatctggagggggacgacccggac
gcgttgctcgccgcccgtctcgtctgtgattggtccctgagcgaagaacacatcgctgag
ttcctaagccatttttag

DBGET integrated database retrieval system