KEGG   Roseobacter litoralis: RLO149_c031400Help
Entry
RLO149_c031400    CDS       T01572                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rli  Roseobacter litoralis
Pathway
rli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rli00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLO149_c031400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AEI95096
UniProt: F7ZJS1
Position
3222776..3223153
Genome map
AA seq 125 aa AA seqDB search
MFQKLTIGLLALTLAAPAFASGDPASGEKVFRKCKACHAVGEDAKNKVGPTLNGIIGAAA
GANPDFKYSDALMTMAGDGLVWTEEEMAAFLKKPKEYMPKTKMSFAGLRKDDDIADVIAY
LATFN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttccagaaactcacaatcggcctgctggccctgaccctcgcggcccctgcgttcgcc
tcgggtgatccagccagcggcgaaaaagtctttcgcaaatgcaaagcctgtcacgccgtg
ggcgaagacgccaaaaacaaggtgggccccacgctgaacggcatcattggggccgctgcg
ggggctaatcctgatttcaaatattcggatgcgctgatgacgatggccggtgacggtctg
gtgtggaccgaagaggaaatggcggctttcctcaaaaaacccaaggaatacatgcccaag
accaagatgagctttgcgggtctgcggaaagacgacgatatcgcggacgtcatcgcctat
ctcgcgaccttcaactga

DBGET integrated database retrieval system