KEGG   Roseobacter litoralis: RLO149_c032620Help
Entry
RLO149_c032620    CDS       T01572                                 

Definition
(GenBank) putative dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rli  Roseobacter litoralis
Pathway
rli00010  Glycolysis / Gluconeogenesis
rli00020  Citrate cycle (TCA cycle)
rli00620  Pyruvate metabolism
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01200  Carbon metabolism
Module
rli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c032620
   00020 Citrate cycle (TCA cycle)
    RLO149_c032620
   00620 Pyruvate metabolism
    RLO149_c032620
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RLO149_c032620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl E3_binding Ser_hydrolase Esterase Biotin_lipoyl_2 UPF0227 PGAP1 Thioesterase
Motif
Other DBs
NCBI-ProteinID: AEI95213
UniProt: F7ZKJ9
Position
complement(3356438..3357715)
Genome map
AA seq 425 aa AA seqDB search
MPVEVIMPKVDMDMASGTVSAWHVEIGATVVKGDPLFDIETDKAAMEVEAQNDGVLYHCV
PAGTEVAIGQPVAWLYDKDEEVGDAPVATPETVSENTTECSEPASDQAADVPNPLETQTA
RTDKTRATPRARTLVREAGIDITAVTGSGPRGRIQAKDVPQTSDPAFASPTIFVPETGLL
NITYRNGGTRNPIVLIHGFASDTKSWKQIEPFLADHPLIRIDLPCHGKSPNLRISSFSDL
VKTVRQTFDDLHLDGTQLIGHSLGGAVALAIADTRPSKVNSLCLIAPAGLGPDINGATLS
GIAKASRAESIAPWLKTLVQDDTLISEGYVRSVMATRTQSNMRAAQIALAGIVFPDGTQA
FDLKAALSRVEMPTRLIWGRRDKIIPWQHALTAPGNVAIHLFEDTGHLPHIERPEQIGKL
LATSI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgaagtcatcatgccaaaggtcgatatggatatggccagcggaactgtgagc
gcatggcatgttgagatcggtgcgactgttgtcaagggagaccccctgtttgatatcgaa
accgacaaagccgcgatggaggtcgaggcccaaaacgatggtgtgctgtatcactgcgtt
cctgcggggaccgaagtggccataggccagccggttgcttggctttacgacaaagacgag
gaagtcggggatgcccccgttgctacgccggagactgtctccgaaaacacaactgaatgc
tctgaaccggcctctgatcaggccgctgacgtgccaaaccctttagagacgcaaaccgca
cggactgacaaaacccgtgcgaccccacgtgcccgcaccctcgtgcgcgaagccggtatc
gacattaccgcagtaacgggcagtggcccgcgcgggcgcatacaagccaaagacgtgccg
caaacgtctgaccctgcgttcgcatcaccgacaatattcgtgccggaaactgggctcctg
aacatcacttacagaaacgggggcacgcgaaaccccatcgttttgatccacggtttcgcc
agtgacactaaatcatggaagcagatcgaaccctttttagcggaccatcccctgatccgc
atcgatctgccctgccacggtaaatccccaaacctgcgtatcagcagcttctccgacctt
gtaaaaacggtgcgccaaacatttgatgatctgcatctggacggaacacaactcattggc
catagtcttggcggtgccgtcgcactggcgattgcagatacccggccgagtaaagttaac
tcgctttgcctaatcgcacctgctggccttggccctgatattaacggtgcgaccctgagc
ggcatcgcaaaggcatcccgtgcagaaagcattgcgccatggctgaaaacgctcgtccaa
gacgacacgctgatcagcgaaggttacgtccgttccgttatggcgacgcgcacacagtcc
aacatgcgggctgctcaaatcgctcttgcgggcattgttttcccggatgggactcaggct
tttgatctaaaagctgctctcagcagggttgaaatgcccacccgtctgatttggggtcgc
cgggataaaatcataccatggcagcacgcgctgacagcgcccggtaacgtcgcaatccac
ctttttgaggacactgggcacctacctcatatcgaacgtcccgaacagatcggcaaactg
ctggcaacgtcaatttga

DBGET integrated database retrieval system