KEGG   Roseobacter litoralis: RLO149_c039250Help
Entry
RLO149_c039250    CDS       T01572                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rli  Roseobacter litoralis
Pathway
rli00970  Aminoacyl-tRNA biosynthesis
rli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RLO149_c039250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rli03029]
    RLO149_c039250
Enzymes [BR:rli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RLO149_c039250
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RLO149_c039250
Mitochondrial biogenesis [BR:rli03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RLO149_c039250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEI95827
UniProt: F7ZDP2
Position
complement(3978510..3979892)
Genome map
AA seq 460 aa AA seqDB search
MRGCVATVAQIESFGGNGMQAWLKMTAADLGRGIATGEIDPVDLTQTYLDAISAHPLRDR
IYARVTAERALNEAAAARDRARSGQRRSLLDGVPISWKDLFDTAGVATESGSLLLKDRVP
DQDAQVLQNATAAGLVCLGKTHMSELAFSGLGYNPSTATPPCVNDEGAVPGGSSSGAAAS
VAFDLAAVGVGSDTGGSVRIPAAWNDLVGLKTTSGRLSLEGVVPLAARFDTVGQLCRSVE
DAALMLAVLQGGRAADLSGASLVGRRLAVLNTIAMEDVRSGPAEAFSTAVSKLEQAGAQI
EEIHIDAVNDAMALTTCLYTAEAYGLWRDVIEANPDAMYQEILKRFRLGQNHSGPDYVAA
WAALEAARVSYHQATAGFDAVILPTAPILPPNLNRLNTDHDYYVTENLMSLRNTRIGNLM
GLCALSLPTDTPSCGLMLMAPPHREESLLRLGTAAERALA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggttgcgtcgctaccgtcgcacaaatcgaaagcttcggggggaatggcatgcag
gcttggctcaaaatgacggcggctgatctgggcagggggatcgccacgggggaaatcgac
ccggtcgatctcacacaaacctatctggatgcgatcagcgcacatccgttacgggataga
atttacgcccgtgtgacagcagagcgtgccttgaacgaagcggcagccgcccgggatcgc
gcgcgcagtggtcagcgtcgttcgctgctggatggtgtgccgatcagttggaaggatctg
ttcgatacggcgggtgttgcaactgagtcgggatcgctgcttttgaaggatcgcgtgcct
gatcaggatgcacaggtgctgcaaaacgccaccgccgccgggcttgtttgtctcggcaag
acacatatgagcgaattggcgttttctggtctgggctataaccccagcacggcgacgccg
ccttgcgtcaatgatgagggcgcggtgccgggcgggtcttcttccggtgcggcggcctct
gtggcgttcgatctggcggctgttggtgttggctctgataccggcggttcggtgcgtatt
ccggcggcttggaacgaccttgtgggtctcaagacgacgtcggggcggctgagccttgaa
ggggtcgtgcctctcgctgcgcgctttgatacggtcggccagctgtgccgttctgtcgag
gatgcagcgctgatgctggcggtgctgcaagggggcagggcggcggatctatccggggca
tcccttgtcggcaggcgtttggcggtgctgaacaccatcgcgatggaagatgtacgcagc
ggtcccgcagaagcgttttccaccgctgtttccaagctggaacaggcgggggcgcagata
gaggagatccatatcgacgcggtaaacgatgcgatggccctgaccacatgcctatatacc
gccgaggcctatgggctgtggcgcgacgtgatcgaggcgaacccggacgcgatgtatcag
gaaattctcaagcgctttcgtcttggccagaaccattccgggccggattatgtcgctgct
tgggcagcacttgaggcggcccgcgtttcttaccatcaagcgacggccgggtttgatgcg
gtcattttgccgacggcacccattttgccgccgaatctgaacaggttgaacacggatcac
gactattacgtcacagaaaacctgatgtcgctgcgcaatacgcgcattggcaatctgatg
gggctttgcgcgttgagcctgccaacggatacgcccagttgcgggcttatgctgatggca
ccgccgcaccgtgaggaatcccttttgcgtctgggaacggcggcggaacgggctttggcc
taa

DBGET integrated database retrieval system