KEGG   Roseobacter litoralis: RLO149_c043190Help
Entry
RLO149_c043190    CDS       T01572                                 

Definition
(GenBank) putative regulcalcin
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
rli  Roseobacter litoralis
Pathway
rli00053  Ascorbate and aldarate metabolism
rli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    RLO149_c043190
Enzymes [BR:rli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     RLO149_c043190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Lactonase
Motif
Other DBs
NCBI-ProteinID: AEI96215
UniProt: F7ZI79
Position
complement(4376000..4376875)
Genome map
AA seq 291 aa AA seqDB search
MQISVLADVKPLLGEGPLWDTEGERLWFIDSLGCRIFRCTSEGAEMRAWTVPSAIGSMCL
RAGGGAIVALTDGFHALDLDSGEIQHIIDPEPDQPDNRLNDGKVDPKGRFLCGSMDTGEA
VPTGTLWRLDTDMSLHALEKGIICSNGPCWSPDGQTLYFSDSFSGEISAFDYDVETGCVA
NRRTFAALPTERGGAPDGATVDGEGGIWSACVFDGRIFRFMPDGTVDRVIEMPVCKVTSV
AFGGADLGTLYVTSMAEPPLPKYPGDGPLRGATFRIDGLGVTGRPEPRFAG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttcggttcttgcagacgtcaaacccctgctgggagagggcccgctctgggac
acggagggcgagcggctctggttcattgacagcctcgggtgccgcatttttcgctgcacc
agtgaaggtgcggaaatgcgagcttggaccgtaccctcggccatcgggtcgatgtgcctg
cgggcgggtggcggggcaatcgtggcgctgacggacgggtttcacgccttggatctggac
agtggagagatccagcacatcatcgacccggaacccgaccaaccggacaaccgcctgaac
gacggaaaggtggatccgaagggacggtttctctgtggctcaatggacaccggcgaggca
gtgccaaccggcaccctctggcgtctggacacggatatgagcctgcacgcgctggaaaag
ggcatcatttgttccaacggcccgtgctggtcacctgacgggcagacgctctatttctcg
gatagtttttcaggtgaaatctctgctttcgattacgacgtggaaactggatgcgttgcc
aaccgcagaacctttgccgcactgccgacggaacgcggcggcgcgccggatggggcgaca
gtggatggcgaaggcggaatctggtcggcatgcgtattcgatggccggattttccgtttc
atgcctgacggaaccgtggatcgggtgatcgaaatgcccgtgtgtaaggtcacatcggtt
gccttcggcggtgcagaccttggcacgctttacgtgacctcaatggcggaaccgcctttg
ccaaaatatcccggcgatggcccgttgaggggcgccacgtttcgcatcgatgggctgggt
gtgacgggccgccctgaaccccgttttgcaggataa

DBGET integrated database retrieval system