KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0635Help
Entry
Rleg2_0635        CDS       T00779                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00260  Glycine, serine and threonine metabolism
rlt00750  Vitamin B6 metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01230  Biosynthesis of amino acids
Module
rlt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg2_0635
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rleg2_0635
Enzymes [BR:rlt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rleg2_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACI53932
UniProt: B5ZSY3
Position
complement(660113..661528)
Genome map
AA seq 471 aa AA seqDB search
MDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFTILS
PFTNGEIPEATFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLA
RLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQMTTS
TAANVHALAVEGNFDDCQNLVKAMFNDAAFRDKVNLSGVNSINWARIMAQIVYYFTTAVA
LGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDMKAV
KATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSNGFEIGPQALKAIRRDFRA
GRASEKQVAETIRKTHAETGYLLDPHSAIGVFVASKKEKPNTPMVTLSTAHPAKFPAAVK
SACGIDPALPTWLADLMHREERFQIIEPELKAVETFIGKHARGKTTAGAER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtggactatatctcgacccgcggcgaggcccctgccctcggcttttgcgacgccctgctg
acgggcctggcgcgcgatggcgggctctatgttccccgtgaatggccgcagttttcgaag
aaagaaatccgcgcgctgaggggcaagacctatcaggaaatcgccttcaccatcctttcg
cccttcaccaatggcgagatccccgaggcgaccttccgggcgatgatcgacgaggcctac
ggcaccttccgccatccggcgatcgcgccgctcgtccagaccgggccgaacagttttgtc
atggagctgttccacggcacgacgctcgccttcaaggatgtggcgatgcagctgctcgca
cggctgatggattatgcacttgagaagcgcggcgagcgggcgacgattgtcggcgccacg
tcgggtgataccggcggggcggcgatcgacgcctttgccgggcgcgagcgcaccgacatc
ttcattctcttcccgcatggcaaggtctcgccggtgcagcagcggcagatgacgacgtca
acggccgccaatgtgcatgcgcttgccgtcgaaggcaatttcgacgattgccagaacctg
gtgaaggcgatgttcaacgacgcggcgttccgcgacaaggtcaatctctccggcgtcaac
tcgatcaactgggcgcgcatcatggcccagatcgtctattatttcacgaccgcggtggcc
ttgggcgggccggaccggaagatctcgttcacggtgccgacaggcaatttcggcgatatc
ttcgccggctactgcgccaagcgcatgggtctgccgatcgaccggctggtcatcgccacc
aacgaaaacgacattctggcgcggacactgaagaccggccgctacgacatgaaggctgtg
aaggcaacgagctcgccgtcgatggatatccagatctcgtcgaatttcgaacggctgctt
ttcgaagcctatggacgcgacgcctcgaaggtgcgcgcggccatggaaagcctcaagcaa
tccaacggcttcgagatcggcccgcaggcattgaaggcgatccgccgcgacttccgggcc
ggccgcgccagcgagaaacaagtggccgagacgatccgcaagacccatgccgagaccggc
tatctccttgatccgcattcggcgatcggcgtcttcgtcgccagcaagaaggaaaagccg
aatacgccgatggtgacgctttcgaccgcgcatccggcgaaattccccgccgccgtaaaa
tcggcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatgcacagggag
gagcgcttccagatcatcgaaccggagctgaaagccgtagagacctttatcggcaaacac
gcccgcggcaagacgacggcaggcgcagaaagatag

DBGET integrated database retrieval system