KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0947Help
Entry
Rleg2_0947        CDS       T00779                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACI54241
UniProt: B5ZVI2
Position
complement(970359..971372)
Genome map
AA seq 337 aa AA seqDB search
MRAVAYNSPQPITAETSLIDIELPMPEARGHDLLVEIKAVSVNPADVKIRAHVAPPTDEP
RVLGWDAAGIVKAVGADVTLFKPGDQVFYSGALARSGTNAEFHLVDERIVGAKPKSLDFA
AAAALPLTTITAYEALFDRLKVQDPVSGAARSILIIGGAGGVGSIAIQIARVLTDLTVIA
TASRRETQDWVKDLGAHHVIDHSSPIAPQVAALGIGAPGFIFSTTNTDLHIGDIVEVIAP
QGRFALIDNPKTLDVVPFMRKSASIHWELMFTRPLFETPDMIEQHRLLNRISELVDAGKI
RTTLSETIGPINAANLKKAHAMVETGRMKGKAVLAGF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgttgcctacaatagcccacaacccattaccgccgagacctcgctgatcgat
atcgagctgccgatgccggaagcccgaggccacgacctgctggtcgagatcaaggccgtt
tccgtcaatccagccgatgtcaaaatccgcgctcatgtggcgccgcccacggacgagccg
agggtgctgggctgggatgccgccggcatcgtcaaggccgtcggcgccgacgtcaccctg
ttcaagcccggcgaccaggtgttctattcgggcgccctcgcccgctccggcaccaatgcc
gaattccatctcgtcgacgagcgcatcgtcggcgccaagccgaagagcctcgatttcgcc
gctgctgcagcgctgccgctgaccacgatcaccgcctatgaggctctgttcgatcggctg
aaggtgcaggatccggtttcgggtgcggcgcgctccatcctcatcatcggcggcgctggc
ggcgtcggctcgatcgccatccagatcgcgcgggtgctgaccgatctcaccgtcattgcc
acggcgtcgcggcgtgaaacgcaggactgggtgaaggatctcggcgcccaccacgtcatc
gaccattccagcccgatcgcgccgcaggtggcagcgctcggcatcggcgccccaggcttc
atcttctcgacgacgaacaccgacctccatatcggcgacatcgtcgaagtcatcgcgccg
cagggccgcttcgcgttgatcgacaatccgaagaccctcgatgtcgtgcccttcatgcgc
aagagcgcctctatccactgggagctgatgtttacccgtccgctcttcgaaacgcccgac
atgatcgagcagcacaggctgttgaacaggatttccgagctcgtcgacgccggcaaaatc
cgcacgacactttccgaaaccatcggcccgatcaatgcggcaaacctgaagaaagcgcat
gcgatggttgaaacgggccggatgaagggcaaggctgtgcttgccgggttctga

DBGET integrated database retrieval system