KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1769Help
Entry
Rleg2_1769        CDS       T00779                                 

Definition
(GenBank) metallophosphoesterase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00790  Folate biosynthesis
rlt01100  Metabolic pathways
rlt02020  Two-component system
Module
rlt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rleg2_1769
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rleg2_1769
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rleg2_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ACI55055
UniProt: B5ZPT5
Position
1809992..1810822
Genome map
AA seq 276 aa AA seqDB search
MKIIQITDTHFSPNKPHFNGNWAPLLSWIEATGADLIIHTGDLTVDGADKDEDITFSMDL
MRQVSVPMLIVPGNHDVGHLKGSDQPVNPERLARWRSLAGDDRWLEDAAGWRFIGLNSLL
LGHEDEEEEAQFEWLAKALEDRAGRRVALFAHKPLFVDAPDEGDTGYWSVRPAQRRRLYD
LIAAHDVALFASGHLHWAWQGRFDNTQLTWGPSAAFIIDKMEREMPGERLIGAVVHEFDT
SVESEIVAVPGMTAHVLDDVVLEVYPQAVKPREPVE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattcagatcaccgacacccatttcagcccgaacaagccgcatttcaacggc
aactgggcgccgcttctgagctggatcgaagcgaccggcgccgatctgatcatccacacc
ggcgatctcaccgtcgacggcgccgacaaggacgaggacatcaccttctcgatggatctg
atgcgccaggtgtcggtcccgatgctgatcgtccccggcaatcacgatgtcggccatctc
aagggatcggaccaacccgtcaatcctgagcggctggcccgctggcgcagccttgccggt
gacgatcgctggctggaggatgcggccggctggcgcttcatcggcttgaattcgctgctt
ctcggccatgaggacgaggaagaagaggcgcagttcgaatggctcgccaaggcgctcgaa
gacagggcagggcggcgcgtggctctcttcgcgcacaaacctctcttcgtcgatgcgccc
gatgaaggcgataccggctactggagcgttcgtccggcgcagcgccggcggctttatgat
ctgatagcagcccacgacgtggcgctgtttgccagcggccaccttcactgggcctggcag
ggccgcttcgacaacacccagctgacctggggtccgtcagccgccttcatcattgacaag
atggagcgcgagatgccgggcgagcgcctgatcggcgccgtcgtccacgagttcgataca
tcagtcgaaagcgagatcgtcgccgttcccggcatgaccgcgcatgtgctcgacgatgtc
gtgctcgaggtctatccccaggctgtcaagccgcgggaacccgtcgaatga

DBGET integrated database retrieval system