KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1822Help
Entry
Rleg2_1822        CDS       T00779                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01130  Biosynthesis of antibiotics
rlt01230  Biosynthesis of amino acids
Module
rlt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg2_1822
Enzymes [BR:rlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rleg2_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NuDC
Motif
Other DBs
NCBI-ProteinID: ACI55107
UniProt: B5ZPY7
Position
1869117..1869929
Genome map
AA seq 270 aa AA seqDB search
MSDILKKIELYKREEIAAAKAAVSLADLKAMQAGQSAPRGFYKALVAQRDAGNFGLIAEI
KKASPSKGLIRPDFDPPALAKAYEAGGAACLSVLTDTPSFQGAPEFLTTARDACALPALR
KDFMFETYQVHEARAWGADCILLIMASLTDDEAERLQDEAFSLGMDVLVEVHDAEEMERA
LKLSSPLIGINNRNLRTFEVSLTVSETLASMVPADRLLIGESGIFTHADCKRLQAVDIST
FLVGESLMRKDDVTAATRALLFGEAAIAAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctgaagaagatcgaactttacaagcgcgaggaaatcgccgccgccaag
gctgcggtgtcgcttgccgacctgaaggcgatgcaggccggccagtccgctccgcgtggt
ttctacaaggcgctcgttgcccagcgtgacgccggcaatttcggcctgatcgccgagatc
aagaaggcgagcccgtccaagggcctcattcgcccggatttcgatccgccggcgctggca
aaggcttacgaagccggtggcgccgcctgcctttccgtgctgaccgacacgccgagcttt
cagggtgccccggaattcctgacgacggcacgggacgcctgtgccctgcccgctttgcgc
aaggatttcatgttcgagacctatcaggtccatgaggcgcgcgcctggggcgccgactgc
attctgctgatcatggcgtcgctgaccgatgacgaggccgagcggctgcaggacgaggcc
ttctcgctcggcatggatgtgctggtcgaggttcacgatgccgaggagatggagcgggcg
ctgaagctttcctcgccgctcatcggtatcaacaaccgcaatctgcggaccttcgaggtc
agcctgacggtcagcgagacgcttgcctccatggttcccgccgaccgactcctcatcggc
gaaagcggcatcttcacccatgccgattgcaagcgtctgcaggccgtcgatatcagcacc
ttccttgtcggcgaaagcctgatgcgaaaagacgacgtaacggccgccacccgcgcgctg
ctcttcggcgaagccgccatcgcggccgaatga

DBGET integrated database retrieval system