KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2748Help
Entry
Rleg2_2748        CDS       T00779                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rleg2_2748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rlt02022]
    Rleg2_2748
Two-component system [BR:rlt02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Rleg2_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE
Motif
Other DBs
NCBI-ProteinID: ACI56019
UniProt: B5ZY36
Position
complement(2795060..2795761)
Genome map
AA seq 233 aa AA seqDB search
MAVRTGISDDAAHLLVVDDDSRIRALLNRYLAENGFRVTVAADGAEAQRKLAGLDFDLII
MDVMMPGESGIDVTRGLRAIKNVPIIMLTALAESGNRIEGLEAGADDYLSKPFDPRELVL
RINNILRRNAGGEGPKIEQVMFGPYTFSLTRKELKKASEVIRLTDREQEIMLLFARRAGD
TIPRHELIGNDTEVGERTIDVQINRLRRKIEDDPANPVWLQTVRGIGYRLSID
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaggacaggtatttccgacgatgcggcgcatctgctggtggtcgacgacgac
tcgcgcatccgcgcgctgctcaatcgttatctcgccgagaacggcttccgcgttaccgtc
gccgccgacggcgccgaggcgcagcgcaagctcgcgggtctcgatttcgacctgatcatc
atggatgtgatgatgccgggcgaatccggcatcgacgtcacccgcgggcttcgcgccatt
aagaatgttccgatcatcatgctgacggcgttggcagagtccggcaaccgcatcgagggc
ctcgaggccggcgccgacgactatctttccaagcccttcgatccgcgcgaacttgtgctg
cgcatcaacaacatcctgcgtcgcaatgccggcggggagggaccgaagatcgaacaggtg
atgttcggcccctacaccttctcgctgacccgcaaggagctgaagaaagccagcgaggtg
atccggctgaccgaccgcgagcaggagatcatgttgctctttgcacggcgtgccggcgat
acgatcccccgccatgagctgatcggcaacgacaccgaggtcggcgagcggacgatcgac
gtgcagatcaaccggctgcggcgtaagatcgaggatgatccggccaatcccgtctggcta
cagaccgtgcgcggcatcggatacaggctaagcatcgactaa

DBGET integrated database retrieval system