KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3178Help
Entry
Rleg2_3178        CDS       T00779                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Rleg2_3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACI56445
UniProt: B5ZNJ7
Position
complement(3261819..3263420)
Genome map
AA seq 533 aa AA seqDB search
MADIAPSQVHSDASHPLHSSNSSGKWFLPLFALVLVCGLGYVAYALGRDLTTAVAVPWIL
LGLALLIALGFEFVNGFHDTANAVATVIYTRSMPAEFAVIWSGFFNFLGVLTSSGAVAFG
ILALLPVELILQVGSGSGLAMVFALLIAAIVWNLGTWYLGLPSSSSHTLVGSIIGVGLAN
QFLAPAGTATSGVDWSQATNIGLSLLISPLIGFGLSAVLLLVMKLLVRNKALYAEPKGNQ
PPPLWIRAILICTCTGVSFAHGSNDGQKGMGLIMLILIGLVPTAFALNRTPDVNYLEAYK
SASVQVETALAKYVRPGVAVTDYKAEVSNAVKNKTWTDATTPALQQYIHQTSAEVAAFPT
LEAVPTNLVGNVRNDIYLIGEALKLIDKQKLLPMDAGDLSAVTNYHKAVDNATKFIPLWV
KVAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYGQGAAAEVVAMVTIASADHLGLPVST
THVLSSGVAGTMAANGSGLQWSTVRNMLMAWVLTLPASIAIAFVLFVILRQVF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccgatattgcccccagccaggttcatagcgacgcttcccacccgctccacagctcg
aattcatcaggcaaatggttcttgccgctcttcgcgctcgttctggtctgcggtcttgga
tatgtcgcctatgcgctcggacgcgacctgacaaccgcagttgcggttccctggattctc
ctgggccttgcgctgctgatcgcgctcggcttcgaattcgtcaacggtttccacgatacg
gccaatgccgtcgccaccgtcatttacacccgttcgatgcctgccgaattcgccgtcatc
tggtcgggcttctttaacttcctcggggtgctgacctcgagcggcgccgtcgctttcggc
attctggcgctgctgccggtggaactcatcctgcaggtcggctccggttccggccttgcc
atggtcttcgcgctgctgatcgccgcgatcgtctggaatctcggcacctggtatcttggc
ctgccgtcgtcgagctcgcatacgcttgtgggttcgatcatcggtgtcggcctcgccaac
cagtttctcgcgccggcaggcacggcgacgagcggcgtcgactggtcgcaggcgaccaat
atcggcctgtcgctgctgatctcgccactgatcggcttcggtctttccgctgttctgctg
ctggtgatgaagcttctggtgcgcaacaaggcgctctatgccgaaccgaagggcaaccag
ccgccgccgctctggatccgcgcgatcctgatctgcacctgcaccggcgtcagcttcgcc
cacggctccaacgacggccagaagggcatgggtctgatcatgctcatcctgatcggcctg
gtgccgacggccttcgcgctgaaccgcacgccggatgtgaactatctcgaagcctacaag
tcggcatcggtccaggtcgaaaccgcgctcgccaaatatgtgaggccgggtgtcgccgtc
accgactacaaggccgaggtcagcaacgccgtcaagaacaagacctggacggatgcgacg
acaccggccctgcagcaatatatccatcagacaagcgccgaagtcgccgccttcccgacg
ctcgaagcggtgccgaccaatctcgtcggcaacgtccgcaacgacatctacctgatcggc
gaggcgctgaagctgatcgacaagcagaagctgctgccgatggatgccggcgatctctcg
gcggtcacgaactaccacaaggcagtcgacaatgcgacgaagttcatccccctctgggtg
aaggtggcggtcgcgatcgcgcttggcctcggcacgatggtgggctggaagcgcatcgtc
gtcaccgtcggcgaaaagatcggcaagacgcatctgacgtacggtcagggcgcggcagcc
gaagtcgtggcgatggtcaccatcgcttcggccgatcacctcggcctgccggtctcgacc
acgcatgtcctgtcgtcaggcgtcgccggcaccatggcggcgaacggttccggcctgcaa
tggtcgaccgtgcgcaacatgctgatggcctgggtgctgacgctgccggcatcgatcgcg
atcgccttcgtgctcttcgtgatcctgcgccaggtattttaa

DBGET integrated database retrieval system