KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3419Help
Entry
Rleg2_3419        CDS       T00779                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00860  Porphyrin and chlorophyll metabolism
rlt00970  Aminoacyl-tRNA biosynthesis
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rleg2_3419
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rleg2_3419
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rlt01007]
    Rleg2_3419
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rlt03016]
    Rleg2_3419
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rlt02048]
    Rleg2_3419
Enzymes [BR:rlt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Rleg2_3419
Amino acid related enzymes [BR:rlt01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Rleg2_3419
Transfer RNA biogenesis [BR:rlt03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rleg2_3419
 Prokaryotic Type
   Other AARSs
    Rleg2_3419
Prokaryotic defense system [BR:rlt02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Rleg2_3419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c HTH_37 NitrOD5
Motif
Other DBs
NCBI-ProteinID: ACI56686
UniProt: B5ZQW4
Position
3534985..3536439
Genome map
AA seq 484 aa AA seqDB search
MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKV
LDALKWCGLEWKEGPDIGGPYGPYRQSDRKPMYQPYAEELLDKGHAFRCFCTPARLEQMR
EAQRAAGKPPKYDGLCLSLTAEEVTSRMAAGETTVIRMKIPAEGSCDFTDGVYGDVSIPW
DSVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPVF
MHLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFIQIAEGEELLTMEELS
AKFDPENLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQARVLAWAMENDRLKAGLRLSQT
RISKLGELPDLAGFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETIE
AELRAIADRMGKKLKVVVSPLFVAVSGSSRSLPLFDSMAILGRSVVRQRLKLAAQAVAAL
VGSK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttccggcgtccgcgtccgcatcgctccctcgccgaccggcgagccgcatgtc
ggcaccgcttacatcgctctcttcaactaccttttcgccaagaagcacggcggcgagttc
atcttgcgcatcgaggataccgacgcgacgcgctcgaccccggaattcgagaccaaggta
ttggacgccttgaaatggtgcgggctggaatggaaggaaggccccgatatcggcggtccc
tacggcccctatcgccagtccgaccgcaagccgatgtaccagccttacgctgaggagctg
ctggacaagggccatgccttccgctgtttctgcacgcccgcgcgtctcgaacagatgcgc
gaggcgcagcgcgccgccggcaagccgccgaaatatgacgggctctgcctcagcctgacg
gcagaggaagtgacctcgcgcatggcagccggcgagacgaccgtcatccgcatgaagatc
ccggctgaaggctcctgcgacttcaccgacggcgtctacggcgatgtctccatcccctgg
gattccgtcgacatgcaggtgctgatcaaggccgacggcatgccgacctatcacatggcc
aacgtcatcgacgaccatctgatgaagatcacccatgtggcgcgcggcgaggaatggctg
gcttcggtgccgaagcacatcctgctctatcgctatttcggctgggaccagccggtcttc
atgcatctgtcgctgatgcgcaatgccgacaagtcgaagctgtcgaagcgcaagaacccg
acctcgatctcctattattctgcgctcggttatatccccgaagcgctgatgaattttctc
ggcctgttcttcatccagatcgccgaaggcgaagagctgttgacgatggaggagctctcc
gcgaagttcgatccggagaacctctccaaggccggcgcgatcttcgacatccagaaactc
gactggctgaacggccgctggatccgcgagaagctctccgaggaagaattccaggcgcgt
gtgctcgcctgggcgatggaaaacgatcgtttgaaggcgggtctccgcctgtcgcagacg
cgcatttccaagctcggcgaactgcccgatctggccggcttcctgctgaagtccgatctc
ggcctgcagccgtccgacttcgccaagatcaagtctccgccggaagagatcctggagatc
ctcaacaccgttcagccggatctggaaaagatcctggaatggaatgtcgagacgatcgag
gcagagctgcgcgccatcgccgaccgcatgggcaagaagctgaaggtcgtggtctcgccg
ctcttcgtcgccgtatcaggctcgtcgcgttcgctgccgctcttcgattccatggcgatc
ctcggccgctccgtcgtgcgccagcgcctgaagctcgcagcccaggccgtcgccgccctc
gtcggctcgaaataa

DBGET integrated database retrieval system