KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3822Help
Entry
Rleg2_3822        CDS       T00779                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00071  Fatty acid degradation
rlt00072  Synthesis and degradation of ketone bodies
rlt00280  Valine, leucine and isoleucine degradation
rlt00310  Lysine degradation
rlt00362  Benzoate degradation
rlt00380  Tryptophan metabolism
rlt00620  Pyruvate metabolism
rlt00630  Glyoxylate and dicarboxylate metabolism
rlt00640  Propanoate metabolism
rlt00650  Butanoate metabolism
rlt00900  Terpenoid backbone biosynthesis
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01200  Carbon metabolism
rlt01212  Fatty acid metabolism
rlt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg2_3822
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg2_3822
   00640 Propanoate metabolism
    Rleg2_3822
   00650 Butanoate metabolism
    Rleg2_3822
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rleg2_3822
   00072 Synthesis and degradation of ketone bodies
    Rleg2_3822
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rleg2_3822
   00310 Lysine degradation
    Rleg2_3822
   00380 Tryptophan metabolism
    Rleg2_3822
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rleg2_3822
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rleg2_3822
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rleg2_3822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rlt04147]
    Rleg2_3822
Enzymes [BR:rlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rleg2_3822
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rleg2_3822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt B12-binding
Motif
Other DBs
NCBI-ProteinID: ACI57084
UniProt: B5ZU91
Position
complement(3955943..3957124)
Genome map
AA seq 393 aa AA seqDB search
MSSSSIVIASAGRTAVGSFNGAFATVPAHELGAAVIKGALARAGVDAGEVDEVILGQVLS
AGEGQNPARQAAIKAGIPKEATAWGVNQLCGSGLRAVALGMQQIATGDAKIIVAGGQESM
SMAPHAMHLRGGVKMGDAKMVDTMIKDGLTDAFHGYHMGITAENIARQWQLSRDEQDQFA
VASQNKAEAAQKAGRFADEIIPYIIQTRKGDVTVDADEYIRHGATLEAMGKLRPAFDKEG
TVTAANASGLNDGAAAAVLMSEAEAVRRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LERAGWSVGDLDLVEANEAFAAQACAVTKDLGWDPAIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGAKQGLATLCIGGGMGVAMCFEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttcatccatcgtcatcgccagtgcaggtcgaacggccgtcggctcgttcaac
ggcgctttcgcaacggttcccgcgcatgagctcggcgcggccgtgatcaagggtgcgctc
gcgcgcgccggcgtcgatgccggcgaagtggatgaggtgatcctcggtcaggtgctctct
gccggcgagggccagaacccggcgcgccaggcggcgataaaagccggcattccgaaggag
gcgacggcctggggcgtcaaccagctctgcggttcgggtctgcgcgccgtcgcgctcggc
atgcagcagatcgccaccggcgacgccaagatcatcgttgccggcggccaggaatccatg
tcgatggcgccgcatgccatgcacctgcgcggcggcgtcaagatgggcgacgccaagatg
gtcgacacgatgatcaaggacggcctgaccgatgccttccacggctaccacatgggcatc
accgccgagaatatcgcccgtcagtggcagctttcgcgcgacgagcaggatcagttcgcc
gtcgcctcgcagaacaaggcggaggcggcgcagaaggccggccgctttgccgacgagatc
atcccctacatcatccagacgcgtaagggcgacgttacggtcgatgccgacgaatatatc
cgccacggcgccacgctggaggcgatgggcaagctgcgcccggccttcgataaggagggc
acggtgacggccgcgaatgcctccggcctcaacgacggtgccgctgctgcggtgctgatg
agcgaagcagaagccgtccggcgcggcatccagccgctcgcccgcatcgtttcctgggca
acggcgggcgtcgatccgcagatcatggggaccggcccgatcccggcatcccgcaaggcg
ctcgaaagggccggctggtcggtcggcgatctcgatctcgtcgaagccaacgaggctttt
gcggcgcaggcctgcgccgtcaccaaggatctcggatgggatccggcgatcgtcaacgtc
aacggcggggcgatcgcgatcggccatccgatcggcgcttccggcgcgcgcgttctcaac
acgctgttgttcgaaatgaagcgccgcggcgccaagcagggccttgctacgctttgcatc
ggcggcggcatgggtgtcgccatgtgcttcgaagcactttaa

DBGET integrated database retrieval system