KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3920Help
Entry
Rleg2_3920        CDS       T00779                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00010  Glycolysis / Gluconeogenesis
rlt00620  Pyruvate metabolism
rlt00640  Propanoate metabolism
rlt00680  Methane metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_3920
   00620 Pyruvate metabolism
    Rleg2_3920
   00640 Propanoate metabolism
    Rleg2_3920
  Energy metabolism
   00680 Methane metabolism
    Rleg2_3920
Enzymes [BR:rlt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rleg2_3920
Lipid biosynthesis proteins [BR:rlt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rleg2_3920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACI57182
UniProt: B5ZV36
Position
complement(4067778..4069733)
Genome map
AA seq 651 aa AA seqDB search
MSEKIYPVTKPVKARALIDKEKYLKWYEESVENPDKFWGKHGKRIDWFKPYTKVKNTSFT
GKVSIKWFEDGQTNVSYNCIDRHLKTNGDQVAIIWEGDNPYIDKKVTYNELYEHVCRMAN
VLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTF
VITCDEGLRGGKPVPLKDNTDTAIHIAARQHVHVSKVLVVRRTGGKTGWAPGRDLWHHQE
IATVKPECPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTHEYVFDYHDGDV
YWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTA
IRSLMGAGDDFVTRSSRSSLRLLGTVGEPINPEAWEWYYNVVGDKRCPVIDTWWQTETGG
HMITPLPGAIDLKPGSATVPFFGIKPELVDNEGKVLEGAADGNLCITDSWPGQMRTVYGD
HDRFIQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVLNVSGHRLGTAEVESALVSHN
LVSEAAVVGYPHPIKGQGIYCYVTLMAGHEGTDTLRQDLVKHVRAEIGPIAAPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVDDLIANRQNKATA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaagatctatccggtcacgaagccggtgaaggcgcgcgccctgatcgataag
gaaaagtacctgaaatggtacgaggaaagcgtcgagaatccggacaaattctggggcaaa
cacggcaagcggatcgactggttcaagccctataccaaggtcaagaacacgtcctttacc
ggtaaggtttcgatcaagtggttcgaagacggtcagaccaacgtctcctataattgcatc
gaccgccatctgaaaaccaacggcgaccaggtggcgatcatctgggagggcgacaatccc
tatatcgacaagaaggtcacctacaacgagctctacgaacatgtctgccggatggcgaac
gtgttgaaaaagcacggcgtcaagaagggtgatcgcgttaccatctatatgccgatgatc
ccggaagcggcttacgcgatgctcgcctgcgcccgcatcggcgcggtgcattcggtggtg
ttcggcggcttttcacccgaggcgctggccgggcgtatcgtcgactgtgaatccactttc
gtcatcacctgcgacgaaggtttgcgcggcggcaagccggtgccgttgaaggacaatacc
gatacggcgatccatatcgccgcccgccagcatgtgcatgtcagcaaggtgctggtggtg
cgccgcaccggcggcaagaccggctgggcgccaggccgcgatctctggcatcaccaggaa
atcgccacggtgaagccggaatgcccgccggtgaagatgaaggcggaagatccactcttc
attctttatacctcaggctcgaccggcaaaccgaagggtgtgctgcacacgaccggcggt
tatctcgtctatgcggcgatgacgcatgaatatgtcttcgactaccatgacggcgacgtc
tattggtgcaccgccgatgtcggctgggtcaccggtcactcctatatcgtctacgggccg
ctcgccaactgcgcgacgacgttaatgttcgagggcgtgccgaatttccccgatcagggc
cgcttttgggaagtcatcgacaaacacaaggtcaatatcttctataccgcgccgacggcg
atccgctcgctgatgggggccggcgacgatttcgtcacccgctcctcgcgctcgtcgctg
cggctgctcggcactgtgggcgaaccgatcaatccggaagcctgggaatggtattacaat
gtggttggcgacaagcgctgcccggtcatcgatacctggtggcagactgaaaccggcggc
cacatgatcacgccgctgcccggcgccatcgatctgaaacccggttctgcgacagtgccg
ttcttcggcatcaagcctgaactggtcgacaatgaaggcaaggtgctggaaggggccgcc
gacggcaatctctgcatcaccgacagctggccgggccagatgcgcacggtctatggcgat
cacgaccgcttcatccagacctatttctccacctacaaggggaaatatttcaccggcgac
ggctgccggcgcgatgcggacggctattactggatcactggccgcgtcgacgacgtgctt
aacgtctccggccaccggctcggcaccgcggaggtggaatccgcactcgtctcgcacaat
ctggtttcggaagccgcggtcgtcggttacccccacccgatcaagggccagggcatctat
tgctatgtgacgctgatggccggacacgaaggaacggacacgctccgccaggacctggtg
aaacatgtccgtgccgaaatcggcccgatcgctgcacccgacaagatccagtttgcgccc
ggcctgccgaagacccgttccggcaagatcatgcgccggatcctgcgcaagatcgccgag
gacgatttcggtgctctcggcgatacctcgacgctcgccgatcctgccgttgtcgacgat
ctgatcgccaaccggcaaaacaaggcgacggcctga

DBGET integrated database retrieval system