KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5068Help
Entry
Rleg2_5068        CDS       T00779                                 

Definition
(GenBank) polar amino acid ABC transporter, inner membrane subunit
  KO
K02029  polar amino acid transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5068
Transporters [BR:rlt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    Rleg2_5068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACI58284
UniProt: B6A100
Position
pRLG201:complement(714757..715479)
Genome map
AA seq 240 aa AA seqDB search
MNSSTSIFQLLAVSPPGWGGVLLTGALATLFISFGAYLVGMALGLFGALGKLSGVPPVRF
ALNFYTTVVRAVPELVLIVALYYAGTDGLNRALSWAGIGPIEVNGLVAAIAVLGFVQGAY
MTEVLRGAILSIPAGQLEAAKAFGMRPTLRFRRIILPSLIPNALPGFANLWLSVIKDSAL
IAVVGYQELALAARVAASNTKQYMLFFLAAAMLYLAITIISNLLFSALEAHFRRGQRPIH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctcgacctcgattttccaacttttggctgtttcgcctcccggctggggcggc
gttttactgaccggtgcgctcgcgactttgttcatttccttcggggcctaccttgtcggt
atggccctcggattgttcggggcgcttggcaagctcagcggtgtgccccctgtccgcttc
gccctgaatttctatacgacggtggtgcgcgcagtcccggaactcgtcctcatagtggct
ttatactacgccggcactgacggccttaaccgtgctctctcttgggccggcatcgggcca
atcgaggtgaacggcctcgtggctgccatcgcagttctgggattcgtgcaaggggcttac
atgacggaagtgctgcgaggagccatactttcgatccccgcaggccaactcgaagcggca
aaggcgttcggtatgcggccgacgctacgctttcgacggatcatactgccgtcgctgatc
cctaatgccctgcccgggttcgctaacctgtggctgtcggttatcaaagacagcgccctg
atcgcagtcgtcggctatcaggaactggctctagctgcccgtgtcgctgcaagtaacacc
aagcaatacatgctgttcttccttgcagccgccatgctctacctggcaattaccatcatc
tccaatctgctcttttctgcgctcgaagcccacttccgccgcggccagcgacccattcac
tag

DBGET integrated database retrieval system