KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5697Help
Entry
Rleg2_5697        CDS       T00779                                 

Definition
(GenBank) ABC transporter related
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
K01998  branched-chain amino acid transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt02010  ABC transporters
rlt02024  Quorum sensing
Module
rlt_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rleg2_5697
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5697
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Rleg2_5697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 ABC_tran AAA_21 AAA_30 AAA_23 SMC_N AAA_16 AAA_22 AAA_29 DUF3584 TsaE AAA_27 AAA_28 AAA_33 AAA_15 NB-ARC AAA_13
Motif
Other DBs
NCBI-ProteinID: ACI58872
UniProt: B6A389
Position
pRLG202:96244..98001
Genome map
AA seq 585 aa AA seqDB search
MRDRQKLRLVLLLALALAALLLIVFGPMFLGRFSLNVLTRSMIYAMLAITVDLLWGYTGV
LTFGQAAFFGVGAYATAMVLTHIGASPALFVVALVAAVLVPLVLGLAVGWLSFYHGSTPL
YATVISLVVPIVVTQLVFSGGTWTGSSSGLVGYDTLPLGLPGYFRLSGACLLALAIVAIV
FVRSDAGRLLVAIRDNEARVAYLGMNPARLKIVLTGVLAGVCGLAGFLYANASGVVAPEN
TGFVFGTELVVWTALGGRGTIIGPMFGAIGIDYLSASLSGDLPFLWQLIVGALFVVMIIL
LPGGLASLVTRFLKTANSNSTLKSLPTRIVARNGPAAGKSLLSIRGLGKSYGSLSVLKGI
DLEIGAGELVSLVGPNGAGKTTLMRCLSDGTEKVEGQVDVIGTNIAGRAPERIVALGVGR
KFQVASIFDSMTIGECLKMARLSRETPNPVRSSAEIMLPPAAAEILTLTGMAEMLDKPVV
LLSHGQRQALELAMVVALEPRIILLDEPTAGLTKIERMTIGTILKKLTDEMGFAAILVEH
DLDFVREISSRIVVLHQGKLVLDGTVNDVVNSETVRTIYAGGAHG
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgacagacaaaaactccggcttgtccttcttctggcgctggcgctcgcagccctc
ctgctgatcgtcttcggaccgatgtttctcggccgtttcagcctcaacgtcctgacgcgc
tcgatgatctacgccatgctggcgatcaccgtcgacctgctctggggttatacgggcgtt
ctcaccttcgggcaggctgcattctttggcgtcggcgcctatgccaccgccatggttctc
acccatatcggcgcaagtccggcgcttttcgtcgtcgcccttgtcgccgccgtactcgtt
ccgctggtgcttggcctcgccgtcggctggctgtcgttctatcacggatcgacaccgctc
tatgccaccgtgatctcgctcgttgtgccgatcgtcgtcacacagctggtcttttcgggc
ggcacctggaccggttcctcgagcggccttgtcggttacgacactctgccgctcgggctt
cccggctacttccgcctgtcgggcgcctgcttgctggcattggccattgttgcgatcgtc
tttgtccggtcggacgccggccgtctgcttgtcgcaatccgcgacaatgaagcccgcgtc
gcctatctgggcatgaatccggctcggttgaagatcgtcctgacgggcgttcttgccggc
gtatgcggccttgcgggcttcctctatgccaatgcatccggtgtcgtcgccccagagaat
accggcttcgtcttcggaaccgaactcgtggtctggacggcgcttggtggccggggaacg
atcatcgggcccatgttcggcgcaatcggcatcgattatctgagtgccagcctgtcgggc
gatctgcccttcctctggcaactgatcgtcggtgcgctcttcgtcgtcatgatcatcctt
ttgccgggcggcctcgcctccctggtgacgcgtttcctcaagaccgcaaactccaacagc
actctcaagtccttgccgacgcgcatcgtcgccaggaatggtccggcggcaggcaaaagc
cttctgtcgatccgcggtctcggcaagtcctatggcagcctctccgtcctcaagggcatc
gacctggaaatcggcgccggagaactcgtcagcctggtcggcccgaacggcgccggcaag
accacgctgatgcgttgtctgtcggacggcaccgagaaggtcgaaggtcaagtagatgtc
atcggcaccaatatcgccggtcgtgcaccggaacggatcgtcgccctcggcgtcggccgg
aaattccaggtcgccagcatcttcgacagcatgacgatcggcgaatgcctgaagatggca
cggctcagccgcgaaacacccaacccagtccgatcatccgccgagatcatgctgccgcca
gctgcagccgagatcctgacgctcaccggcatggctgagatgctggacaaaccggtcgtg
ctgctgtcgcacggtcaaaggcaggctctcgaactggcaatggtcgtcgctctggaacca
cgcatcatcctgctcgacgaaccgacggcgggtcttaccaagatcgagcgcatgaccatc
ggcactatcctcaagaaactgacggacgagatgggttttgccgccatcctggtcgaacac
gatctggatttcgtgcgtgagatatcgagccgcatcgtggttctccaccagggtaagctg
gttctcgacggcacggtgaatgacgtggtcaattccgaaacggttcgcaccatctacgca
ggaggcgcacatggctga

DBGET integrated database retrieval system