KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5714Help
Entry
Rleg2_5714        CDS       T00779                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02025  multiple sugar transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Module
rlt_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5714
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Rleg2_5714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACI58889
UniProt: B6A3A6
Position
pRLG202:114854..115786
Genome map
AA seq 310 aa AA seqDB search
MSMANSGDRRGPVSSLLQNNNVLGFLFMLPAAVFLVCFLTYPLGLGVWLGFTDTRIGRDG
IFIGLENYQFLMDDSVFWLSVFNTILYTSVASVLKFALGLWLAMLLNQHLPYKSFFRAIV
LLPWVVPTVLSALAFWWIYDSQFSIISWSLMKLGLISGPINFLGDPINARISVIVANVWR
GIPFVAISLLAGLQTIPASLQEAASLDGATSWQRFRYVTLPMLTPIIAVVMTFSVLFTFT
DFQLIYVLTKGGPVNATHLMATLSFQRGIPGGQLGEGAAIAVAMVPFLLGAIMFSFFGLQ
RRKWQQGGQD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggcaaattcgggggataggcgtgggccggtctcttcgctcctgcagaacaac
aatgtgctcggcttcctgttcatgctgccggcggcggtgttccttgtctgctttctcacc
tatccgctggggctcggcgtctggctcggctttaccgatacccggatcggccgcgacggc
atcttcatcgggctggagaactaccagttcctgatggacgactccgtcttctggctgtcg
gtcttcaacaccattctctatacctccgtcgcctcggtgctgaaattcgcgctcggcctc
tggctggcgatgctgctcaaccagcatctgccctacaaatccttcttccgggccatcgtc
ctgctgccctgggtggtgccgacggtgctttcggcactggccttctggtggatctacgat
tcccagttctcgatcatctcctggtcgctgatgaagcttgggctgatcagcggaccgatc
aacttcctcggcgatccgatcaatgcgcgcatatccgtcatcgtcgccaatgtctggcgc
ggcattcccttcgtggcgatctcgctgcttgcgggactgcagacgatcccggcgtcgctg
caggaagcagcctcgctcgacggcgccacgagctggcagcgtttccgctatgtgacgctg
ccgatgctgacgccgatcatcgctgtcgtgatgaccttctcggtgcttttcacctttacc
gatttccagctcatctacgtgctgaccaagggcggtcccgttaacgcgacgcatctgatg
gcgacgctgtcgttccagcgcggcattcccggcggccagcttggcgagggtgcggccatc
gcggttgccatggtgcccttcctgctcggcgcgatcatgttcagcttcttcggcctgcag
cggcgcaaatggcagcagggcggccaggattag

DBGET integrated database retrieval system