KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5720Help
Entry
Rleg2_5720        CDS       T00779                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI58895
UniProt: B6A3B2
Position
pRLG202:119652..119933
Genome map
AA seq 93 aa AA seqDB search
MNGISKTLNDMTLVERSSLLDTVADALEATAEEAEGEGDARFVANSICIANTIRGLSGQL
APRDLRAAELLLEQGIMLVHQFSSRVKPGGMKH
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatatcgaaaaccctgaacgacatgacgctggtcgagcggtcgagcctgctc
gacaccgtcgccgacgccctggaggcaaccgccgaggaggccgaaggggagggcgacgcc
cgcttcgtcgccaattccatctgtatcgccaatacgatccgaggattatccgggcagctt
gcaccgcgcgatctgcgggcggccgagctgctcctcgagcagggtatcatgctcgttcac
caattctccagcagggtgaaaccaggcggaatgaagcattag

DBGET integrated database retrieval system