KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5722Help
Entry
Rleg2_5722        CDS       T00779                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K05548  MFS transporter, AAHS family, benzoate transport protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5722
Transporters [BR:rlt02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Aromatic acid:H+ symporter (AAHS) family [TC:2.A.1.15]
    Rleg2_5722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Motif
Other DBs
NCBI-ProteinID: ACI58897
UniProt: B6A3B4
Position
pRLG202:complement(122462..123763)
Genome map
AA seq 433 aa AA seqDB search
MYGEGKLAIQDLAIFKERVRSPNIIIALCGLLILFDGYDLIVYGAVAPALLGEASWGLTP
GLVGRAASITLFGMLLGALVAGTLADRIGRRKVIIGSLLSFSVMMIGSGLAPNFLVFEGT
RFLAGLGLGALFPTVTALIIEFSPPKRKAIAYSIALLGYLAGGIISGILGMLLIQKYGWR
PLMIIGGAPSLLLPFFIRLIPESPEWLATKSRQPEANQIANQYGLPNPVARPVAPRQAGI
VSLFSEGRLLPTLNAWGIHFCSLLLTFGMVNWLPTIMNKMGYDLGSALLFSVTLNLGAAI
GLLIGARIADRGNVKIVVSGMFLLGACSIWLLTQVDQGLQVYGLVALAGTGTIGTQILAN
ILVGNLYPVEIRGTGLGFSLGIGRIGGMIGPAIGGAVLGAGLAPQWNFYIFATVGALGCI
LALMTLLYSKKAD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggagggaaaattggccatacaagatctcgctattttcaaggaacgcgttcgc
agtccgaacatcatcattgccctttgtggtctgctgatcctgttcgacggctatgacctg
attgtgtacggcgcagtcgcgccggccttgctcggtgaagctagctggggcttgacgccc
ggcctggtcggtcgcgctgcctccatcaccctgttcggcatgctgctgggcgctctcgtt
gcgggaacgctcgctgacaggataggccgtcgcaaggtgatcataggcagtctactgagc
ttctccgtcatgatgatcggcagcggtcttgcgccgaactttctcgttttcgagggaaca
cgatttctcgcgggtctgggccttggagctctctttcccacggtaaccgcgttgatcatc
gagttttctccgccgaaacggaaggcaatcgcctattcgattgcacttcttggttatctc
gccggcggcatcatttcgggtatccttggaatgttgctgatacagaaatacggatggcgg
ccactgatgatcatcggcggcgcaccgagcctgcttctgcctttcttcatccgtctcata
cccgagtcccccgaatggctggcgacgaagagccgccagcccgaagccaaccagatcgca
aaccagtacgggctgcccaatcctgtcgcccggccggttgcgccacgccaggccggcatc
gtatcgctgttttccgaaggtcgcctgctgccgaccttgaacgcatggggcatccacttc
tgttcgcttctgttgacattcggcatggtcaactggctcccgaccatcatgaacaagatg
ggctatgacctcggttctgccctgctgttttcggtaacgctcaatctcggagccgcaatc
ggcctcctgattggcgcaaggattgccgaccgcggaaatgtcaaaattgtcgtgtcaggc
atgtttcttctcggagcctgctcgatctggttgctgacgcaggtggatcagggcctccag
gtctatggtctcgtcgcacttgcagggaccggaacgatcggcacgcagatcctcgccaat
attctggttggaaacctctatccggtcgagattcgtggaactggccttggcttctcgctc
ggcatcggccgtatcggaggtatgataggaccggccatcggtggtgcggttctcggcgca
ggcctggctccgcagtggaatttctacatcttcgcaacggtaggagccttgggatgcatc
ctcgcgctcatgacattgctgtattccaaaaaggctgactga

DBGET integrated database retrieval system