KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5729Help
Entry
Rleg2_5729        CDS       T00779                                 

Definition
(GenBank) YCII-related protein
  KO
K09780  uncharacterized protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rleg2_5729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YCII
Motif
Other DBs
NCBI-ProteinID: ACI58904
UniProt: B6A3C1
Position
pRLG202:129337..129633
Genome map
AA seq 98 aa AA seqDB search
MIVVRYAVSDPGKAAERSRLLEQHKAYLYGAAIRILLSGPSAPPAEGKGSTAVVIADVET
LAEFETFSAGDPFVRAGVYRSVDVFEWRPSFGLLLDSL
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgtccgctatgcagtatcagatcccggcaaggctgccgaacgttcccgattg
ctcgagcaacacaaggcctatctgtacggcgcggcgatccgcatcctgctttccggtccc
tctgcaccgccggcagaaggaaagggttctaccgccgtggtgatcgcggacgtcgaaacg
ctggccgagttcgagacgttcagcgcaggagatcccttcgtccgcgccggcgtttacagg
agcgtcgatgtattcgaatggcggcccagttttgggcttctgctggacagtctttga

DBGET integrated database retrieval system