KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5733Help
Entry
Rleg2_5733        CDS       T00779                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ACI58907
UniProt: B6A3C4
Position
pRLG202:complement(132392..133576)
Genome map
AA seq 394 aa AA seqDB search
MKIAPQQRIYVCFFLFAVSLGALLSRMPDLQVALGVDKSELGLTLIGAAIGALISLTLSS
PVIARLGARTTAFITVLGTSALLSLVPWIGAAPVVFCVLFVEGLLAGALEINLNVEIDRI
EAQLGRGVMNRAHGFWSLGFFVTALVSSVVRQAGISMQLHLAVTFVAVLVLGVWAISGMR
NAPARTPLNEGKAPLVALPTRSLMPLCVIGIAAFLVEGAGIDWSAIYMRDVFSVEPFIGG
LGLTLFTFCMALARLFVDPLVDRFGPRAVATMLLVLSAIGICAVWGAPHAYVALAGFALM
GAGCSAVYPLAVSAAAQRIDRAAHLNVAALGQMTFVVFFLAPPLLGFIAEHAGIRTSYLV
CLPLIIYALFSVKVLAQRRAACDGSVASVRSVNG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcgccgcagcagcggatctatgtctgcttctttctcttcgccgtgtcgctg
ggggcgctgttgtcgaggatgccggatttgcaggttgcgcttggcgtcgacaagtcggag
cttgggttgacgttgatcggggctgcgatcggcgccttgatttcgttgactttgtcttcg
ccggtgatcgcccgccttggcgcgcggacaacggcattcattactgttctcggcacgtct
gcgttgctgtcgctggtgccgtggatcggtgcggcgccggtcgtgttctgtgtgcttttc
gtcgagggattgctcgccggggcgctggagatcaatctcaatgtcgagattgatcgcatc
gaagcacagttaggacgcggcgtgatgaacagggcgcatggtttctggagcctcggcttc
ttcgtcacggcgcttgtctcctcagtcgtccgccaagccggtatttcgatgcaactccat
ctcgccgtgacctttgtcgcggtgcttgtgctcggcgtctgggcgatttcaggcatgcgc
aatgcgcccgcgcgaaccccgttgaatgaaggcaaggcgccactggtggcgcttcccacc
cggagccttatgccactctgcgtgatcggcatcgcggcctttctcgtcgaaggtgccggg
atcgactggtcggcgatctatatgcgcgacgtgttttcagtcgagccctttattggcgga
ctaggattgacgctctttactttctgcatggcactggcgcgcctgttcgtcgatccgctg
gtcgatcggtttggcccgcgggccgtcgccacgatgttgcttgtcctttcggcgatcggc
atttgcgccgtctggggcgctccgcatgcctatgtggcactggcgggctttgccttgatg
ggcgccggctgcagcgcggtctatcctctcgccgtctcggcggcggcccagcgcatagat
cgcgcggcacatctcaacgtcgccgcccttggccagatgaccttcgtcgtcttcttcctg
gcgccgccgctgctcggtttcattgccgaacatgcgggcatcaggacatcctatctcgtc
tgccttccgttgatcatctacgcgctcttttcggtcaaggtgcttgctcagcgccgggcg
gcctgcgacggcagcgttgcgagcgttcggagcgtcaacgggtga

DBGET integrated database retrieval system