KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5737Help
Entry
Rleg2_5737        CDS       T00779                                 

Definition
(GenBank) ABC transporter related
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt02010  ABC transporters
Module
rlt_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rleg2_5737
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5737
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     Rleg2_5737
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    Rleg2_5737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 SbcCD_C AAA_23 RsgA_GTPase ESX-1_EspG
Motif
Other DBs
NCBI-ProteinID: ACI58911
UniProt: B6A3C8
Position
pRLG202:complement(136532..137983)
Genome map
AA seq 483 aa AA seqDB search
MDEVLKAVIAVDGAKVSFGAVRALDGVTLRVMPGECVGLVGHNGAGKSTIVSVINGGLTP
HEGSVASDGERLERYGINAARARGVRCVFQELSLCPNLSIVENTRIMHRHLGGFGWRRRA
AGIIEKSLDAVFPGHGIDSGRAVGDLSIAERQMVEISMAFSDAGVAPRLVILDEPTSSLD
ASLARQMLDHVRRFVAAGGSVIFISHILHEILETSDRIVVMKDGRVVAERPADGFDHHGL
VEAMGTVAKKETAQRSTRDQSTAPLILSHQTKGLPFTARKGEIIALAGLAGHGQTELLLA
LHAAQSSNWLPERDPLVTFVAGDRRLNGVFELWSILRNFSIASLGDLTRRGLILANDEET
KGADWKRRIEIRTPDMANRILSLSGGNQQKVLFARALATRAPIVLMDDPMRGVDVGTKQE
VYAIIREEAAHGRTFIWYSTEMDEVRLCDRVYVFREGRITAELAGDAVNETNIIAASFEG
VAA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggttttgaaggcggtgatcgccgtcgatggcgccaaggtgagcttcggtgcg
gtcagggcgctcgacggcgtcacgctccgcgtcatgccgggcgaatgcgtcgggctcgtc
ggccacaatggcgccggcaaatcgacgatcgtcagtgtgatcaatggcggcctcaccccg
cacgaaggaagtgtggcaagcgacggtgagcggctggagcgttatggcatcaacgccgcg
cgggcccgcggcgtgcgctgcgtcttccaggagctttcgctctgccccaacctatccatc
gtcgagaacacgcgcatcatgcatcgtcatctcggcggcttcggctggcgcaggcgcgcg
gccgggatcatcgagaagagcctcgacgccgtctttcccggccacggcatcgacagcggc
cgggccgtcggcgatctgtcgatcgccgagcggcagatggtcgagatttcaatggccttt
tccgacgccggcgttgcgccgcggctggtgatcctcgacgagccgacctcgtcgctcgat
gcgagccttgcccgccagatgctcgatcatgtccgccgcttcgtcgccgccggcggctcg
gtcatcttcatctcgcatatcctgcacgagatcctcgaaacttccgaccgcatcgtcgtc
atgaaggacggccgcgtcgttgccgagcgtccggctgatggattcgaccatcacggtctc
gtcgaagcgatgggcaccgttgcgaagaaggagacggcgcagcgctcgacgcgcgaccaa
tccaccgctccgctcattctgtcccatcagacgaaaggccttcccttcacggcccgcaag
ggagagatcatcgcactggcgggactggccgggcacgggcagaccgaactcctgctcgcc
ctgcatgccgcccagtccagcaactggctgcccgagcgcgatccgctcgtcaccttcgtc
gccggcgaccgccgcctcaacggcgtcttcgaactctggagcatcctgcgcaacttctcg
atcgcttcgctcggtgaccttacccggcgcggcctgatcctcgccaacgacgaggagacg
aagggcgccgactggaagcggcggatcgagatccgcacgccggatatggccaaccgcatc
ctgtcgctttccggcggcaaccagcagaaggtgctctttgcccgcgcgcttgcgacgcgc
gcgccgatcgtgctgatggacgatccgatgcgcggcgtcgacgtcgggaccaagcaggag
gtctacgccattatccgcgaggaagcggcgcacggccgcaccttcatctggtactccacc
gaaatggacgaagtccgcctttgcgaccgtgtctacgtcttccgcgaaggccgcatcacc
gccgaactcgccggcgacgccgtcaacgagacgaatatcatcgctgcatccttcgagggg
gtcgccgcatga

DBGET integrated database retrieval system