KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5739Help
Entry
Rleg2_5739        CDS       T00779                                 

Definition
(GenBank) putative signal transduction histidine kinase
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_2 HisKA_3 GAF GAF_2 Prominin HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACI58913
UniProt: B6A3D0
Position
pRLG202:139352..140590
Genome map
AA seq 412 aa AA seqDB search
MLQLTPAAMFDHYLGISRLLAGQLDFRSAIRSVAAEVAHIIPHDHLDVCVLLEGGNYHTA
YETGIETAWGDLAGAPVVNSPIRSLLWGEVEFLLAEDAMTDPRFHFEGAFKRPIVEESLR
SRLHVPMKVQGTIIAALSCSSRTAGVYTMEDIERARIIADLLTPYFFALQAAEQAQRSAI
VEAEARAREEGLRQGALKLTEALEQERQRIGMDLHDQTLADLTRLARRIDRLSRNGEVTP
EALEPVSRSLQHCMQDLRQIIEQAKPSVLQLFGLAQAIEHHLDRSTRDTGQAIEWGLVDE
THGALERLEPTVSVALFRIAQEAINNAVRHAAPLAVTVRLEADEERLSIEISDDGTGLAK
ARGRIGGGIDNMKTRARLISARFTTGPGHNNRGTVVRVVLPLTPPDPASGPD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaactcacaccggcagcgatgttcgaccactatctcggtatttcccggctgctc
gccggccagctcgacttccgctcggccatccgttcggttgcggccgaggtcgcccatatc
atcccgcacgaccatctcgatgtctgcgtgctcctggagggcggcaactaccacacggcc
tacgagacgggcatcgaaaccgcctggggcgatcttgccggcgcaccggtggtcaacagc
ccgatccgttcgctgctctggggcgaggtggagtttctgctggcggaagacgccatgacg
gacccgcgtttccatttcgagggcgcgttcaagcggccgatcgttgaggagtcgctgaga
agccgcctgcatgtgccgatgaaggtgcagggcacgatcatcgcggcgctctcctgttcg
tcgcgaacggctggtgtctatacgatggaggatatcgagcgcgcccgcatcatcgccgac
ctgctgacgccctatttcttcgcgctgcaggcggccgagcaggcgcagcgctcggcgatc
gtcgaggccgaggcccgggcccgcgaggaggggctgcggcagggcgcgctgaagctgacc
gaggcactggaacaggaacgccagcggatcggcatggacctacacgaccagacgctcgcc
gacctgacgcggctcgcccgccggatcgatcggctgtcgcgcaacggcgaggtgacgccg
gaggcgctggaaccggtctcgcgttcgctgcagcattgcatgcaggatctgcggcagatc
atcgaacaggcaaaaccatcggtgctccagcttttcggtctcgcgcaggcgatcgagcat
catctcgaccggtcgacccgcgacacgggacaggccatcgaatggggtctggtcgacgaa
acgcacggcgcgctggagcggctggaaccgaccgtcagcgtcgcgctattccggatcgcg
caggaggcgatcaacaatgcggtgcgccatgccgcgcccctcgccgtgacggtgcggctc
gaggccgacgaggaacggctgtcgatcgaaatttccgacgacggaacggggcttgcgaag
gcacggggacggatcggcggcggcatcgacaatatgaagacccgggcgcggctgatctcg
gcgcgcttcacgaccgggcccggccacaacaatcgcgggaccgtggtgcgcgtcgtgctg
ccgctgaccccgcccgacccggcaagcgggccggactga

DBGET integrated database retrieval system