KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5761Help
Entry
Rleg2_5761        CDS       T00779                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02034  peptide/nickel transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt02024  Quorum sensing
Module
rlt_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5761
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Rleg2_5761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF3169
Motif
Other DBs
NCBI-ProteinID: ACI58935
UniProt: B6A3F2
Position
pRLG202:complement(165980..166849)
Genome map
AA seq 289 aa AA seqDB search
MADIAIKSAESEGSKFVRRLLKRKTVAFGLLILAIFVLLAVFAPVVAPYSPSKLSIVNRL
KPPGGAFFFGTDEFGRDVFSRTIFAGRLSLLVGVAVVSLSAVIGVTLGLLAGFFQKLDTP
IARLIDAMMAFPDILLAIALVAALGPSLTTVIIALSIVYAPRLARIVRASTLVIRELPYV
EAARALGISTFHIMIRHVLRNLLSPILVQATFLFASAMLAEAGLSFLGLGVSPEIPTWGT
MIAAGRQYIGQADWMTLFPGVAIILSVLSLQMVGDGLRDMLDPRLRKDL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatcgcaatcaaatcagccgagagcgaaggcagcaaattcgtccgccgcctg
ctgaagcgcaagacggtggccttcggcctgctgatcctggcgatcttcgtgctgctggcg
gtcttcgcccctgtcgttgcgccctattcgccctccaagctttccatcgtcaaccggctg
aagccgccaggtggcgccttcttcttcggcaccgacgagtttggccgcgacgtcttctcg
cggacgatctttgccggccgcctgtcgctgttggtcggcgttgcggtcgtcagcctgtcg
gcagtgatcggcgtgacgctcggccttctggccggctttttccagaagctcgatacgccg
atcgcccggctgattgatgcgatgatggccttcccggatattctgctggcgatcgccctc
gtcgccgccctcggcccgtccttgaccacggtgatcattgccctgtcgatcgtctatgcg
ccgcggcttgcccgtatcgtccgcgcctcgacgctggttattcgcgagttgccctatgtc
gaggcggcgagggcgctcggcatttccaccttccacatcatgatccggcatgtgctgcgc
aatctgctgtcgccgatcctggtgcaggccaccttcctctttgccagcgccatgcttgcc
gaagccggcctctccttcctcggcctcggcgtcagcccggaaattccgacctggggaacg
atgattgccgccggccgccaatatatcggccaggccgactggatgacgctgtttcccggc
gtcgccatcattctctcggtgctgtcgctgcagatggtcggcgacggcctcagggacatg
ctcgacccaagacttcgcaaggacctttaa

DBGET integrated database retrieval system