KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5764Help
Entry
Rleg2_5764        CDS       T00779                                 

Definition
(GenBank) protein of unknown function DUF1349
  KO
K09702  uncharacterized protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rleg2_5764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1349
Motif
Other DBs
NCBI-ProteinID: ACI58938
UniProt: B6A3F5
Position
pRLG202:169616..170200
Genome map
AA seq 194 aa AA seqDB search
MNIDFNDGKWLNEPASWQADATGLTITTDEKTDFWRETHYGFTRDSGHFLAFPTTESFTA
QIRIQGEFRTLYDQAGLMVRLDESRWVKTGVEFTDDEAFLSTVITDGRSDWSVSQPFKEL
EDFRIRVTVANGALRIQASRDGRRWPLLRLAPFPAAGHYEVGPAACTPERSGLMVRFSEF
SIGPAITTDLHDLS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgacttcaacgacggaaaatggctgaacgaaccggccagctggcaagctgac
gcaaccggcctcacgataacgaccgacgagaaaaccgatttctggcgcgagacccattac
ggcttcacccgcgacagcggccacttcctcgcctttcccacgaccgagagcttcaccgcc
cagatccgcatccagggcgaattccgcaccctctacgaccaagccggcctgatggtgcgc
ctcgacgaaagccgctgggtcaaaaccggcgtcgaattcaccgacgacgaagccttcctc
agcaccgtcatcaccgacggccggtccgactggtcggtgtcgcaacccttcaaggagctg
gaggacttccgcatccgcgtcaccgtcgcaaacggtgccctgcgcatccaggcctcccgc
gacggccgccgctggccgctgctgcgcctagcgcccttccccgcggctggccactacgag
gtcgggcctgcggcctgcacgccggagcggagtgggttgatggtgcggttttcggagttt
tcgatcgggccggcgattacgacagatctgcatgatttgagttag

DBGET integrated database retrieval system