KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5769Help
Entry
Rleg2_5769        CDS       T00779                                 

Definition
(GenBank) filamentous haemagglutinin family outer membrane protein
  KO
K15125  filamentous hemagglutinin
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rlt00536]
    Rleg2_5769
Glycosaminoglycan binding proteins [BR:rlt00536]
 Heparan sulfate/Haparin
  Microbial pathogens
   Rleg2_5769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fil_haemagg_2 Haemagg_act Fil_haemagg
Motif
Other DBs
NCBI-ProteinID: ACI58942
UniProt: B6A3F9
Position
pRLG202:complement(173088..181571)
Genome map
AA seq 2827 aa AA seqDB search
MSREQSKSTTAIGGVAGANERPGRSLARLARQSLALLLSSLLVFQPMLANAQSVSASTTA
PAANQPGVGSAPNGVPLIDIVTPNSQGLSHNKYDNFNVGTPGLILNNFKGEIGNSNLGGV
TPGNPNLNSSGPASVILNEVTSGNRSALNGAIEVFGGRADVVIANPNGITCDGCGFINTP
HATLTTGAPQLGADGKLNGFSVSGGDVTIGPNGGNFSAGSGAVDLFDIVSRSVHVNGPVY
GKSLRVTAGASNFDYATGDAQALAPISGTPEYAIDGTALGAMQADRIKIVVTENGAGVRM
SGDLAANTNELSLSADGKISLGNVSGEQGVSISSKSKVTAAKVTSKAKATIAADQGITLD
TVAAGGDIALSSGSGLLSVGGEVNSAANVLMSSAAGIAAGSVVAGNALTLSSTAGNIQIA
GAVKSADALTITATSGAISAASLVSGNNVALSAGADIGISGDVLAQGNVTASGRSIAAAT
IASGVDFAATAHSANGTLALQQAGSMSLAATNGSITVSNALLSSGNLSATATQNIAYNKL
QSLSNAALMASGQISYGNPTSATGNLTLTTTNIDLSNGAAGNIAAGGTLTLNADSANLSN
NSLTLGGLALNLSGSADLSGATINAVTGAGGSGDIAINADGLSTSASTALLAADDLTLTL
LSLTNAGQLAAKDALTLKISGNFTNNATGLAYAGHDASLFIGGVLTNNQGAILSGNDLEI
AGTASGLRNTGVTNISGLIQAGNDMSILTSELTNKRAATPQWTTGTLISSGVLTGFTLNP
AAAGLPFGYLETADQNMFQLYAGVDPGLWQDYEPLLWSKATLADGTTYRAWTWISADGPE
KVTPIIDWIRARVPRDANGNPVADPNNPSRYFIVDEVNFSGSDESTTYSWDWSSHLSQSV
YEDRLIGTLSPEATIRASRNLTIDATNLTNSYSSIEAGGDATLKGSTLTNTGVTLFRTTT
TTCSAQGACTAYDASGHANPSKNIANGTTIVSSVQAIGGVSANIKAHGALSVDFGSVNNT
SAAGSMAGGASVAAASNPGDPLSALSGLTAGGTLFNVNSGLGTTLVASTNPRSGGFGDPI
PGQTFLFETRAKFLDVGTFYGSAYFMGKIGYQPETTVPFLGDAYFENQLIDTQLRQLVGE
GLGRSTFIAGNSAIEQMKTLLDNGVTYAKDHGLAVGQGLTPEQAAALTESIVLYQMQTVN
GVQVLAPVVYVAAADRQKLTGAGAVMAGGSVDMNVDDLANSGLIASNGGLTIAGKTIQGS
GTFLSRGDTVLNATNGITLAAQTMTIGGQNMVNTNAGVTASGNVQLAGGSGDLALKGVKV
NAGGSAQLSGTNVTLAAAKVDNGGQQNATGTQVASGGALTIKATDNVNIIGSSAKAGTTL
DVTADNGSVAVVSTDVARNNQSGYTRTLSTDQQQSQLSSGTNATITAGDDILLSGSSVKA
GGNIALSAGDDINITAAQEQSASTFGKKSASSITHVGSEIAAGGDLSVKAGNGSGDHDLN
IVGSKLAADGKVALKADGDVTIAEATDTATLDTKLSSKGGFLGTSEKTTTHLETTTAVGS
AITGGGGVDIESGKDTVISASKIEAGKEGGTTPASLNITTGGDLVIASGKDTTAKDDKGS
RSGFLSKGSSSHKSYDETTVASELGASGNINLSAGGAAVIAGSKADADGSINISGDSVSV
VGAQETHELEEQRKKSGFGIGGGGGFISIYGSQQNKGAQASTLNVGSALSAGEDVNLTAK
ATDLNIMGSSVDAERDINLSAARDVNVTPGAESFSQSEQEKKSGFGLSFSAGNGGISIGI
GAQRSKDSSAQQSDTNAASTLSAGRDLNISAGNNLNLQAAQASAERDVNLFATNDINLLS
AADKTNYEEIHEKTFAGVTLSVSSQVSQAASSIMNSAERLAGDTRVNAVTNTAIAGLGFY
QGYKGLKEAYKQLTDTSPTAEGLSFSVSLTAGVNHQENSSSSSSSTPVVTDIRAGRSITL
EAENGSITSDGAQIAAGYDKFGLPTISDDPLAGDIFLSADKGNINLSAATGTSDTSSKNS
SYSFGVGVKWECGTKSKCVPGVSVSGSYGKGNDGTTGLTNYNTHVNGTGDITILTNDLTL
RGATVTGNSVTAAVRNLTVQSLVDTATAEAHQLNLSGSIGTDGFSASGSTQKATGDAAIV
SEQSGIRAGTGGLDLTVDKKTTLVGGLLTSQASEALNHLETGTLEVTDVDTHSRWKADTY
GASIGSGGLSLAKVNDGESETGKAYSAIGGNIGIAITDPEHQTQDIGTIRRDTDNTNTSL
PGLPDLQNILRDQYKTQADLQAAQKTMATLVGDIASELYKQSTTQAERDLWKEGGAGRAL
LHAIGGGILGGVNGWEGAIKAALGGAATTLMAPAIAKLVKGMLKGTKYEGTAEGDALAKL
IGASLATAVGEAVGGAEGAGYGAANYQYNYLYHDEKAAKLKAESNLAACKTKPQSCSQAE
VANLQQEISRYDALDELRDAQVQYACAYGGRLMCLSALQDTYRAAISYAAAHAGYSDQDA
YNAYLRERGIDPNQMAAEAWEIYQLRQSLSETIGDRDAQDMQITLNGLGLGAGIGAGAAA
IYLAPSAFSAAVACARSSVCFYEMGLMVADAAFGEAVGGASYGISFAVASGQLILRKGDQ
IIGVLDQATGKPVQLTEDGLQALRATLPPAPTATARVITLSSDSPTTIIARGSVDFDAFK
RLNVVDPATGKIQPGEASAAAELENYLGGTLGRAEGGSADFVFQSGPYAGKTVDFMLTPN
NVRQAGMANQFFEKNLSAFTENLQLHIDKADLVPLDMRFLTQKNQEMLLNLVDSLPVSQK
SKIILMR
NT seq 8484 nt NT seq  +upstreamnt  +downstreamnt
atgagcagagagcagagcaagtcgacgacagcaataggtggcgtcgccggagcaaatgaa
agacctggtcgcagcctagcacgtcttgcccggcaatcgctcgcgctgttgctgagcagc
ctgctggtctttcagccgatgcttgccaatgcccagtcggtctcggcgagcaccacggcg
ccggccgccaatcagccgggcgtcggttcggcacccaacggcgtgccgctcattgacatc
gttacgccgaacagccagggcctgtcgcacaacaaatacgacaatttcaacgtcggcacg
ccgggcctgatcctcaacaacttcaagggcgagatcggcaactccaatctcggcggcgtc
acgcccggcaatcccaatctcaacagctcagggccggcttcggtcatcctcaacgaagtc
accagcggcaaccgctcggcattgaacggcgcgatcgaggtgttcggcgggcgcgccgat
gttgtcatcgccaacccgaacggcatcacctgcgacggctgcggcttcatcaacacgccg
catgcgacgctgacgacaggggcgccgcagctcggcgccgatggcaagctcaacggcttt
agcgtcagcggcggcgatgtcaccatcgggccgaacggcggcaatttttccgccggatcc
ggcgcggtcgacctcttcgacatcgtctcgcgcagcgtccacgtcaacggcccggtctac
ggcaagtcgctgcgcgtgacggcgggtgcgtccaatttcgactacgccacgggcgatgct
caggcgcttgcgccaatctccggcacgccggaatacgcaatcgacggcaccgcgctcggc
gccatgcaggccgaccgcatcaagatcgtcgtcaccgagaatggcgccggcgtgcgcatg
agcggcgatctcgcggccaacaccaacgaactgtctttgtcggccgacggcaagatctcg
ctcggtaacgtctccggcgagcagggcgtctcgatctcctcgaagtcgaaggtgacggcc
gccaaggtcacgtcgaaagcaaaggccaccattgcagcagatcagggcatcaccctcgat
accgtcgccgccggtggcgatatcgcgctttcgagcggcagcggcttgctgagtgtcggc
ggcgaggtcaacagcgccgccaacgtgctgatgtcgtcggcagccggcattgccgccggc
agcgtcgtggccggcaatgcgctcaccctgtccagcaccgcgggcaacatccagattgca
ggtgcggtcaagagcgccgatgcgctgacgatcaccgcgacatcaggcgcgatctccgcc
gcctcgcttgtcagcggcaataacgtcgcgctttccgccggcgccgatatcggcatatcg
ggcgatgtgctggcgcagggcaacgtcacggcttcaggccgctcgattgcagccgcgacc
atcgcctccggcgtcgatttcgccgccaccgctcattccgccaatggcacgctggcgctg
cagcaggcgggcagcatgagccttgccgccacaaatggttcgattaccgtcagcaatgcg
ctgctcagcagcggcaatctttcggccacggcaacacagaatatcgcctataacaagctc
cagagcctcagcaatgcagcactgatggcctcgggccagatcagctacggcaaccccacc
agcgccaccggcaacctgacgctcaccaccaccaatatcgatctctccaatggcgcagcc
ggcaacatcgctgccggcggcacgctgacgctcaacgccgatagcgccaatctcagcaac
aacagcctcacgctcggcggcctcgccctcaatctctccggctcggccgatctcagcggc
gccaccatcaacgccgtcaccggtgccggcggctccggcgacatcgccatcaatgccgac
ggcctctccacctcggccagcaccgcgctgctcgccgccgacgatttgacgctgacgctg
ctgtcgctgaccaatgccgggcaattggcggccaaagatgctctgacgctcaagatttcc
ggcaatttcaccaacaacgccacgggccttgcctatgccggccacgacgcgagcctcttc
atcggcggggtgctcaccaacaaccagggcgccatcctatccggcaacgaccttgagatc
gccgggacggcatcgggactgagaaacactggtgtcaccaatatttccggcctgatccag
gctggaaacgacatgtccatcctcaccagcgagctgaccaacaagcgggccgccacgccg
caatggacgaccgggacgctgatttcctccggcgtcctgaccggattcacgctcaatccc
gccgccgccggcctgcctttcggctatctcgagaccgcagatcaaaacatgttccagctc
tatgccggcgtcgatccggggttgtggcaggattatgagccgctgctctggtcgaaggcg
acgcttgccgacggcacgacctatcgcgcatggacctggatctcggccgacgggccggag
aaggtcacgccgatcatcgactggatcagggcccgcgtgccgcgggatgcgaacggcaat
ccggttgccgatcccaacaatccgtcgcgctatttcatcgtcgacgaggtgaatttcagc
ggctcggacgaaagcaccacctattcatgggattggtcgtcccatctcagccagtcggtc
tacgaggatcggctgatcggcacgctcagccccgaagcgacgatccgggcaagccgcaac
ctcaccatcgacgccaccaatctcaccaattcctacagctcgatcgaggccggcggcgac
gcgacgctgaagggctcgacgctgaccaacaccggcgtcaccctcttccgcacgacgacg
acgacctgcagcgcccagggcgcctgcaccgcttatgatgccagcggccacgccaatccc
tcgaagaacatcgccaacggcacgacgatcgtgagctccgtccaggcaatcggcggcgta
tcggccaacatcaaggcgcacggcgcgctctccgtcgatttcggcagcgtcaacaacacg
tcggcagccggctcgatggccggcggcgccagcgtcgccgccgcaagcaatcccggcgat
ccgttgtcggcgctctccggcctgacggccggcggcaccctcttcaacgtcaactcgggc
ctcggcaccacccttgtcgcctcaaccaatccgcgctcgggcggtttcggcgacccgatc
ccgggacagacattcctgttcgaaacccgcgccaagtttcttgacgtcggcaccttctac
ggctccgcctatttcatgggcaagatcggttatcagccggagacgacggttccgttcctg
ggcgatgcctatttcgagaaccagctgatcgacacgcagctgcgccaactcgtcggcgaa
ggcctcggcagaagcaccttcattgccggcaacagcgcgattgagcagatgaagacgctg
ctcgacaacggcgtgacctatgcgaaggatcacggcctggccgtcggccagggcctcacg
ccggagcaggcggcggcgctcaccgagtcgatcgtcctctaccagatgcaaaccgtcaac
ggcgtccaggtgcttgcgcctgtcgtctacgtcgcggccgccgaccggcagaaactgacc
ggcgccggcgccgtcatggcgggcggctcggtcgacatgaatgtcgacgatctcgccaat
tccggcctgatcgcgtccaatggcgggcttaccatcgccggcaagaccattcagggcagc
ggaacgttcctgtcgcgcggcgacacggtgctcaacgccaccaatggtattacgctggcc
gcccagaccatgacgatcggcggccagaacatggtcaacaccaatgccggtgtgacggca
tcgggcaacgtgcagcttgccggcggcagcggcgatctcgccctcaaaggcgtcaaggtg
aacgccggcggctccgcccagctctccggcaccaatgtcacgctcgcagcggcgaaggtc
gataacggcgggcagcagaacgccaccggcacccaggtcgccagcggcggagccctgacg
atcaaggcaaccgacaatgtcaacatcattggcagttccgccaaggcgggaacgacgctt
gatgtgaccgccgacaatggctctgtggccgtcgtctcgacagacgtcgcccgcaacaac
cagtccggctacaccaggacgctttccaccgaccagcagcaatcgcagctttcatcaggc
acgaacgcaacgatcacggccggcgacgacatcctgctctccggctcctccgtcaaggcc
ggtggcaatatcgcgctgagcgccggcgacgatatcaatatcactgccgcccaggagcaa
tcggcatccaccttcggcaagaagtccgcctcgtcgatcacccatgtcggctccgagatc
gcagccggcggcgacctctcggtgaaagcgggcaacggcagcggcgatcacgatctcaac
attgtcggcagcaagcttgccgccgacggcaaggtcgctctcaaggccgacggcgacgtg
acgatcgccgaagccaccgacaccgcgaccctcgataccaagctcagcagcaagggcggt
ttcctcggcacgagcgagaagacgaccacgcatctggaaacgacgacggccgtcggctcc
gccatcacagggggtggcggcgtcgatattgaatccggcaaggatacggtcatctccgcc
tcgaagatcgaagccggcaaggaaggcggcaccactccggccagcctgaacatcaccacc
ggcggcgacctcgtcatcgcatcgggcaaggacaccacagccaaggatgacaaggggtcg
cgcagcggcttcctgtccaaaggctcctccagccacaaaagctatgacgaaacgaccgtc
gcctccgaactcggcgcatccggcaatatcaatctgagcgccggcggcgcggcagtgatc
gccggctcgaaggctgatgccgacggctccatcaacatctccggcgacagcgtctccgtc
gtcggggcgcaggaaacgcacgagctcgaagagcagcgcaagaagtccggcttcggcatc
ggcggcggtggcggattcatttcgatttatggcagccagcagaacaagggcgcccaggcc
tcgaccctcaatgtcggctcagcgctttccgctggcgaggacgtcaacctgacggcgaag
gcgaccgatctcaatattatgggttcctcggtcgatgccgaacgcgacatcaacctgtcg
gcggcccgcgacgtcaacgtaacgcccggcgcggaaagcttctcccagtccgagcaggag
aagaagtccggcttcggcctgtccttctctgccggcaatggcggcatctccataggcatc
ggcgcgcaaaggagtaaggacagctccgcgcagcagtccgacaccaatgcggcgtcgacg
ctgtctgccggccgcgacctcaacatctccgccggcaacaatctcaacctgcaggcagca
caagcttcggccgagcgcgacgtcaatctgtttgcgaccaacgacatcaatctgctgtcg
gccgccgataagaccaactacgaggagattcacgagaagacctttgccggcgtgacgctc
agcgtctcaagtcaggtcagccaagccgccagcagcatcatgaactcggctgagcgcctt
gctggcgatacccgcgtcaacgcggtcaccaacaccgccattgccggtcttggcttctat
cagggctacaagggtctgaaggaagcctataagcaactgacggacacgtcgcccacagcg
gaagggctcagcttctcagtgtcgctgacggccggcgtcaaccatcaggaaaacagctcg
tcctcgtcatcgtcgacacccgtcgtcaccgacatccgcgccggccgctcgatcaccttg
gaggctgaaaacggctcgatcaccagcgacggcgcgcagattgccgctggctacgacaag
ttcggtctgccgaccatctccgatgatcctctcgccggcgacatattcctgtcggcggac
aagggcaatatcaacctcagtgcggcgaccggcacctcagatacgtcaagcaagaactcg
tcctatagcttcggcgtcggcgtcaagtgggagtgcggcacgaagtcgaaatgtgtgccc
ggggtcagtgtcagcggttcctacggcaagggtaatgacggcacgacggggctgacgaat
tacaatacccatgtcaatggcaccggcgacatcaccattctcaccaacgacctcactctg
agaggcgccactgtcaccggcaactcggtgaccgctgctgtccgcaatctgacggtccaa
agtctggtggatacggcaactgccgaggcccaccagctcaacctctccggctcgatcggc
acagatggtttcagcgcttccggctcgacgcagaaggcgacgggcgatgctgccatcgtc
tccgagcagtcgggcatccgtgccggtaccggcggcctcgacctgaccgtcgacaagaag
acaacgcttgtaggtggcctgctcaccagccaagcttcagaggcgctgaatcatctcgaa
accggcacgctcgaagtcaccgacgtcgacacccattcgcgttggaaggccgacacctac
ggcgcctcgatcggctccggcggcttaagccttgcaaaggtcaacgacggagagagcgaa
accggcaaggcctattcggccatcggcggcaatatcggcatcgccatcaccgatcccgag
caccagacgcaagatattgggacgatccgtcgcgacaccgacaatacaaacacgtcgctg
ccgggcctgccggatctgcaaaacattttgcgtgaccagtacaagacgcaggccgatctg
caggctgctcaaaagacgatggcgacattggtgggcgatattgcgtctgagttgtacaag
cagtcgacgacccaagccgaacgcgacttgtggaaggagggaggggcaggccgggcgctg
ttgcatgccatcggtggcggtattcttggtggcgtcaatggctgggaaggcgcgattaaa
gcggctctgggcggtgctgcgacgaccttgatggcgccggcaatagccaaactcgtcaag
ggtatgctcaagggcactaagtatgagggaactgcagagggtgacgcactcgctaagttg
atcggcgcaagcctagcaactgccgtgggcgaagctgtgggtggtgctgaaggtgctggg
tatggcgcagcgaactatcagtacaactacctctatcacgatgagaaagcagccaaattg
aaggctgagagcaacctcgcggcctgcaaaaccaaaccacaatcctgcagtcaggctgaa
gtggcgaatctgcagcaggagattagccgatacgacgcgctcgacgaattgcgcgacgcg
caggtgcagtatgcgtgcgcctacggtggtcgcttgatgtgcctgagtgccttgcaggac
acatacagggccgcaatcagctatgcagcggcacatgcgggctatagtgaccaggacgca
tataatgcgtatcttcgtgagcggggcatcgatcccaaccagatggctgctgaagcttgg
gagatttaccagttacgtcagtcgctcagtgaaaccatcggtgatcgcgacgcccaggat
atgcagatcacgctaaatggtcttggtttaggtgctggcattggagccggggctgcagcc
atttacttggcgcctagcgcattctcggcagctgtagcttgtgcacgcagcagcgtctgt
ttctatgaaatgggattgatggtggcagatgccgcctttggcgaagccgttggcggagcc
agctatggcatcagctttgccgttgcttctggtcaacttattctgcggaaaggtgatcag
ataatcggtgtgctcgaccaagcgactgggaaacccgtccagctgacggaagatggtctt
caagccttacgtgctacgcttcccccagcgccgacggcgactgctcgtgtcattaccctt
tccagcgatagtcctacgacaattattgctcgcggctcggttgattttgatgcgtttaaa
cgtcttaatgttgtggatccggctacaggaaagatacagcctggcgaagcgagcgccgca
gcggaactggaaaattatctcggtggcactttaggtagggcagagggaggcagcgccgat
tttgtatttcaatctggaccttatgccggaaaaactgtggacttcatgctcaccccaaat
aatgtgcggcaagctggaatggccaatcagttctttgagaagaatctttcggcattcact
gaaaaccttcagctacacatcgataaggcagacttagtgcctttagatatgcgcttcctt
acgcagaaaaatcaggaaatgttgctgaatttggttgatagtctgcctgtttctcagaaa
agcaaaatcatcctcatgaggtaa

DBGET integrated database retrieval system