KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5771Help
Entry
Rleg2_5771        CDS       T00779                                 

Definition
(GenBank) hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI58944
UniProt: B6A3G1
Position
pRLG202:complement(182523..183077)
Genome map
AA seq 184 aa AA seqDB search
MRFVRFLTLLLLAATLASCVTSDPRLVSALKKTSVSQIRVETAPDITMGGFFDRTKPDPQ
LPAVVRTLQSTMARELTGLPGGPVKGRLVVTLHRVDVSSKAGRVIAGNDSYIQGTVRLED
AKTGQLIAEAQSIRGEDKGVRGDGEIGIVIAMAMNAAQSQGEDALAQKLSNSFTRNVKTW
LTQK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcgtgcgttttctaacccttctcctgctggcggcgacgttggcatcctgcgtc
accagcgatccccggctggtctcggccctcaagaaaacttcggtctcgcagatccgcgtc
gagacggcgccggatatcaccatgggcggctttttcgaccgcacaaagccggacccgcag
ctgcccgcggtggtgcgcacactgcagagcaccatggcgcgcgagttgaccggcctgccc
ggcggtccggtcaagggccgtctggtcgtgactctgcatagggtcgatgtgtcgagcaag
gcgggacgggtgattgccggaaacgacagctacatccagggaacggtgcggctcgaggat
gccaagaccggccagttgatagccgaagcccagagcattcgcggtgaagacaaaggcgtg
aggggagatggagaaatcggcatcgtcattgccatggccatgaatgcggcccagtcccag
ggcgaggacgcgctcgcccaaaagctctccaattccttcacccgcaatgtgaagacctgg
ctcacccagaaatag

DBGET integrated database retrieval system