KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5784Help
Entry
Rleg2_5784        CDS       T00779                                 

Definition
(GenBank) ABC transporter related
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt02024  Quorum sensing
Module
rlt_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5784
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Rleg2_5784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 AAA_16 AAA SMC_N Mg_chelatase AAA_29 TsaE AAA_24 AAA_30 AAA_19 DEAD
Motif
Other DBs
NCBI-ProteinID: ACI58957
UniProt: B6A3H4
Position
pRLG202:195206..196105
Genome map
AA seq 299 aa AA seqDB search
MSDAILALDTVTKSFGHGSAAVHAARAISFSLHAGRALALVGESGSGKTTCARMAMREYL
PTSGRILYKGRPVEAANSAEIGRYRRSVQMIFQDPFASLNPAHTIAHHLRRPLKLHRPEI
KGAEIDVAVRELLQRVRLDPDLVAPKYPHELSGGQRQRVNIARALAVQPEVIVADEPTSM
LDVSVRLGVLNLLNEMKQEMNLGLLYITHDIATARYVAEDIAVMYAGQIVEWGSTARVID
NPLHPYTKLLLSAVPDPDIRFEDPKARLRPDEVDDIRRRSAAPQDEIIEVEPQHFIRMI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccatcctcgcgctcgacaccgtcaccaagagtttcggacacggttcggcg
gccgtgcatgcggcgcgcgccatttccttttcgctgcatgccggccgggcgctggcgctc
gtcggcgaatccggcagcggcaagacgacctgcgcccgcatggcgatgcgcgaatatctg
ccgacatcgggccgcatcctctataagggccggcctgtggaagcggcgaattccgccgag
atcggccgctaccgccgctcggtgcagatgatcttccaggatcccttcgcctcgctgaac
cccgcccataccatcgcccaccatctccgccggccgctgaagctgcatcgcccggagatc
aagggagccgagatcgacgtcgcggtccgcgaactgctgcagcgtgtcaggctcgatccc
gatctcgtcgcgccgaaatatccgcatgaactctccggcggccagcgccagcgcgtcaac
atcgcccgggcgcttgcggtccagccggaggtgatcgtcgcggacgagccgacctccatg
ctcgatgtctcggtccgcctcggcgtgttgaatctgctgaacgagatgaagcaggagatg
aatctcggcctgctctatatcacccatgacatcgccacggcccgctatgtcgccgaggac
atcgccgtcatgtatgccggccagatcgtcgaatggggcagcaccgcaagagtgatcgac
aatccgctgcatccctataccaagctgctgctctccgcggtgcccgatcccgacatccgc
ttcgaggacccgaaggcacgcctcaggccggatgaagtcgacgatatccgccgccgttcc
gccgcgccgcaggacgagatcatcgaagtggagccgcagcatttcatacggatgatctga

DBGET integrated database retrieval system