KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5786Help
Entry
Rleg2_5786        CDS       T00779                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth
Motif
Other DBs
NCBI-ProteinID: ACI58959
UniProt: B6A3H6
Position
pRLG202:196737..197417
Genome map
AA seq 226 aa AA seqDB search
MLPWIQLDSATIPGEGGELRLKQRGSEFSIMLGANELMNSRLSGSEEALATLSWERIKAH
PKPRMLIGGLGMGFTLRAALAILPEDAGVTVAELVPAVVTWARGPMAEVFKGCLDDPRVA
IHQGDVGEAIRAGKGAYDAILLDVDNGPDGLTRKSNDRLYDFAGLRFARDALRPGGVLAV
WSSGPDPDFTRRLRDSGFSVDAVNTRANGKRGGARHVIWLAIKPTR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctggatccagctcgattccgcgaccattcccggcgaaggcggcgaactcagg
ctgaagcagcgcggcagtgaattctcgatcatgctcggcgccaacgagctgatgaacagc
cgcctcagcggctcggaagaggcgctggcgaccctttcctgggagcggatcaaagcgcat
ccgaagccgaggatgctgatcggcgggcttggcatggggttcaccctgcgcgccgccctc
gccatccttcccgaggatgcaggcgtcaccgtcgccgaactggtacccgccgtcgtcacc
tgggcgcgcggcccgatggccgaggtcttcaagggctgtctcgacgatccgcgcgtcgcc
atccatcagggtgatgtcggcgaagcgatccgtgcaggcaagggcgcctatgacgcgatc
ctgctcgatgtcgacaatggcccggatgggttgacccgcaaatccaacgatcggctctat
gatttcgccggcctgcgcttcgcccgagacgcgcttcgccccggcggcgtgctcgccgtc
tggtcatccggtcccgatcccgattttacccgccgcctgagggacagcgggttttccgtc
gatgcggtcaacacccgcgccaacggcaaacgcggcggcgcccgtcatgtcatctggctg
gcgataaagccgacccgctga

DBGET integrated database retrieval system