KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5789Help
Entry
Rleg2_5789        CDS       T00779                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 LysR_substrate HTH_30 HTH_28 MarR_2 HTH_20 HTH_5 HTH_24
Motif
Other DBs
NCBI-ProteinID: ACI58962
UniProt: B6A3H9
Position
pRLG202:complement(198592..199497)
Genome map
AA seq 301 aa AA seqDB search
MPDHSLELGWMRIFVEVARLGSFSSAAALLGLTQPAVSYQIRRLEEQFGVSLLRRQHRGV
TLTAEGERLLDVTAKAVGDIDALARSFRAEAQRPVVRLRTDYAFSSLWLIPRMDGFRLLH
PETDIQIVATQRFAAGFRDEADVAVVFGTRAEFGAAGTLLLQEKVVPVCTQGFLDRNGPF
EDARQLAKAVLIHLDTPMPSPWFDWRSYLTEFSVVRDINAGRGDISFNTYSLVIQAALSG
QGVAIGWMGLVDTLLQAGMLVEAGPPLEAQDRGYWLVPPRSPSPHSESLGAWLVGEVGGS
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccactcgcttgagcttggatggatgcgcattttcgtcgaggtcgcgagactc
gggagcttttcgtcggccgcagcgctgctcgggcttacccagccggccgtcagctaccag
atccgccggctggaggagcagttcggcgtcagcctgctgcgccgccagcatcgcggcgtg
acgctgactgccgaaggcgagcggcttctcgacgtcaccgccaaagcggtcggcgacatc
gatgcgctcgcccgcagcttccgtgccgaagcccagagaccggtcgttcggctcagaaca
gactatgccttttcatcgctttggctgatcccgcgcatggacggctttcggcttcttcat
ccggaaacggacatccagatcgtcgcgacgcagcggtttgcagccggttttcgcgacgaa
gcggatgtcgcggtcgttttcggcacgcgggcggaattcggcgccgccggtacgcttctg
ctgcaggaaaaagtcgtgccggtctgcacgcagggatttctcgatcgcaacggtccgttc
gaggatgcgaggcagcttgccaaggcggtgctgatccatctcgacacgccgatgccatcg
ccctggttcgactggcgcagttatctgacggaattttcggttgtccgcgacatcaatgcc
ggccgcggcgatatcagcttcaatacctactcgctggtcatccaggctgcgttgagcggg
cagggcgtggcgatcggctggatggggctcgtcgatacgctgctccaagcgggcatgctg
gtcgaagccggcccgccgcttgaggcgcaggatcgcggttactggctggtgccaccgcga
tctcccagcccgcacagcgaaagcctcggtgcctggctagtgggcgaagtcggagggagc
ggctga

DBGET integrated database retrieval system