KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5795Help
Entry
Rleg2_5795        CDS       T00779                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI58968
UniProt: B6A3I5
Position
pRLG202:complement(204499..204693)
Genome map
AA seq 64 aa AA seqDB search
MNYVYLKRLYAKRAELEAKLELHDARYCFGEEEVDDGTDSDLRQRLSEISDEIDALEAGR
AARA
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgtctatctcaagcgcctgtatgccaaacgcgccgagctcgaagccaagctg
gagcttcacgatgcgcgctattgtttcggcgaggaagaggtcgatgacggcaccgacagc
gatctgcgtcagcggctgagcgaaatttccgacgaaatcgacgcgctggaagcaggccgg
gccgcgagagcatga

DBGET integrated database retrieval system