KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5807Help
Entry
Rleg2_5807        CDS       T00779                                 

Definition
(GenBank) rhamnulose-1-phosphate aldolase/alcohol dehydrogenase
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Aldolase_II KR Epimerase Urocanase Ldh_1_N 3HCDH_N AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ACI58980
UniProt: B6A3J7
Position
pRLG202:complement(216681..218777)
Genome map
AA seq 698 aa AA seqDB search
MAANVRLLDNRWDDAYAAGLDEPGKLLYRSNLLGADKRITNYGGGNTSAKVMETDPLDGG
TVKVLWVKGSGGDVGTIKLDGFATLYQDKLEALKGIYKGVEDEDRMVGFLPHCTFNLNAR
AASIDTPLHGFVPFTHVDHMHPDAIIAIAASKNSRELTQQIFGAEIGWLPWRRPGFQLGL
DLEAFVKANPNAKGVVLESHGLFTWADDAKACYELTLDIINKAIVWFAEKTEGKTIFGGA
VTESLPVAERRAIAARLMPEIRGRIGKQERKLGHFDDQDAVLEFVNSKDLRPLGALGTSC
PDHFLRTKIRPLIVDFDPAKPDVDAIVAGLDQALEDYRADYARYYNDCKHDNSPAMRDAN
PVIFLVPGVGMLSFARDKATARIASEFYVNAINVMRGASTVSEYQGLPEQEAFDIEYWLL
EEAKLQRMPKPKSLAGRVAFVTGGAGGIGRATAARLVGEGACVVLADIDQAALEGTEADF
VKKFGADAVRSVRLDVTKEVAVVASFAEASVEFGGIDILVSNAGIASSAPIEATELATWN
RNIDILATGYFLVSREAFRLFRRQALGGNIVFVASKNGLAASPNAAAYCTAKAAEIHLAR
CLALEGADAGIRVNTVNPDAVLRGSKIWSGEWREQRAASSKIEVDDLEEHYRKRSMLKLN
VFPEDIAEAIYFLASDLSAKSTGNIINVDAGNVQSFTR
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaacgtccggcttctggataaccggtgggatgatgcatatgcggcaggcctc
gatgagcccggcaagctgctctatcgctccaacctgctcggcgccgacaagcgcatcacc
aattacggcggcggcaacacctcggcgaaggtgatggaaaccgatccgctggatggcggc
acggtcaaggtgctctgggtcaagggctccggcggcgatgtcggcacgatcaagctcgac
ggcttcgccaccctctaccaggacaagctcgaagcgctgaagggcatctataagggtgtc
gaagacgaggatcgcatggtcggcttcctgccgcactgcaccttcaacctcaacgctcgc
gccgcctcgatcgacacgccgctgcacggcttcgtgccgttcacccatgtcgatcacatg
catcccgacgcgatcatcgcgatcgccgcctcgaagaattcgcgggagctgacgcagcag
atcttcggcgccgagattggctggctgccctggcgccgtccgggcttccagctcggcctc
gatctcgaagccttcgtcaaggcgaacccgaatgccaagggcgtcgtgctcgaaagccat
ggcctctttacctgggctgatgatgccaaggcctgctacgagctgacgctcgatatcatc
aacaaggcgatcgtctggtttgccgaaaagactgaaggcaagacgattttcggcggcgcc
gttacggagagcctgcccgttgccgagcgccgcgccattgctgcccggctgatgccggag
attcgcggccgcatcggcaagcaggaacgcaagctcggtcatttcgacgatcaggacgcc
gtgctcgaattcgtcaattcgaaggatttgcgcccgctcggcgcgctcggcaccagctgc
cccgatcatttcctgcgcaccaagatccgcccgctgatcgtcgatttcgatcccgccaag
ccggatgtcgacgcgatcgttgccggcctcgaccaggcgctggaggattatcgcgccgat
tacgcccgctattacaacgactgcaagcatgacaattcgcccgccatgcgcgacgccaat
cccgtcatcttcctcgttcccggcgtcggcatgctgtccttcgcccgcgacaaggcgacg
gcccgcatcgccagcgaattctatgtcaacgccatcaacgtcatgcgcggcgcttcgacg
gtttcggaatatcagggcctgccggagcaggaagccttcgatatcgaatattggctgctc
gaagaggctaagctgcagcgcatgccgaagccgaagagccttgccggccgcgtggccttc
gtcaccggcggcgccggcggcatcggccgggcgacggctgcgcgcctcgtcggcgagggc
gcctgcgtggtgcttgccgatatcgaccaggcggcgcttgagggcaccgaggccgatttc
gtcaagaagtttggcgccgatgcggtgcgcagcgtccggctcgacgtcaccaaggaagtt
gcggtggtcgcctccttcgcggaagcctcggtcgaattcggcggcatcgatatcctcgtc
tcgaatgctggcattgcctcctccgcgccgatcgaagccaccgagcttgcgacgtggaac
cgcaatatcgatattctggcgaccggctatttcctcgtttcgcgcgaagccttccgtctg
ttccgccgccaggcgctcggcggcaacatcgtcttcgtcgcctcgaaaaacggtctcgcg
gcttcgccgaatgccgctgcttattgcacggcaaaggccgccgaaatccatctcgcccgc
tgcctggcgctggaaggtgccgatgccggcatccgcgtcaataccgtcaacccggatgcg
gtgctacgcggttcgaagatctggagcggcgaatggcgcgagcagcgcgccgcctcgtcg
aagatcgaagtggatgatctcgaggaacattaccgcaagcgttcgatgctgaagctcaac
gtgtttccggaagatatcgccgaggcgatctatttcctcgcatcggacctttcggcaaaa
tcgaccggcaacatcatcaacgtcgatgccggcaacgtgcagagctttacgcgttga

DBGET integrated database retrieval system