KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5813Help
Entry
Rleg2_5813        CDS       T00779                                 

Definition
(GenBank) L-rhamnose 1-epimerase
  KO
K03534  L-rhamnose mutarotase [EC:5.1.3.32]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rleg2_5813
Enzymes [BR:rlt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.32  L-rhamnose mutarotase
     Rleg2_5813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rhaM
Motif
Other DBs
NCBI-ProteinID: ACI58986
UniProt: B6A3K3
Structure
PDB: 

Position
pRLG202:224465..224785
Genome map
AA seq 106 aa AA seqDB search
MTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHKSGASDYSIHLDRETNTLFGVLTR
PADHTMASLPEHPVMKKWWAYMADIMAVNPDNSPVQSDLVTLFHMP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaaaaacacgccttcaagatgcagctcaatcccgggatggaagccgaatac
cgcaagcggcatgacgagatctggccggaactggtcgacctcctgcataagtcgggcgcc
agcgactattccatccatctcgaccgtgagaccaacacgctgttcggcgtgttgacgcgg
ccggccgaccacacgatggcgagcctgccggaacatccggtcatgaagaaatggtgggct
tatatggccgatatcatggctgtaaatccggacaattcgcctgttcaaagcgacctcgtc
acccttttccatatgccatga

DBGET integrated database retrieval system