KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5820Help
Entry
Rleg2_5820        CDS       T00779                                 

Definition
(GenBank) inner-membrane translocator
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt02010  ABC transporters
rlt02024  Quorum sensing
Module
rlt_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rleg2_5820
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_5820
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Rleg2_5820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACI58993
UniProt: B6A3L0
Position
pRLG202:complement(231483..232370)
Genome map
AA seq 295 aa AA seqDB search
MTMIFGIPLQALLGQLLIGLINGSFYALLSLGLAIIFGLLRVINFAHGAQYMLGAFVAYL
LLTYAGIGYWPSLILAPVIVGLGGAIIERLFLRRLYDLDPLYGLLFTFGLALAVEGTFRY
LYGSSGQPYATPAALAGGANLGFMFLPIYRGWVVVVSLVVCLGTWLLIEKTKLGAYLRAA
TENAVLVQVFGVNVPVLLTLTYALGAGLAAFAGVLAAPIYQVSPLMGSNMIIVVFAVVVV
GGMGSIMGAIITGYVLGIAEGLTKVFYPEASNIVIFVIMAIVLLIRPAGLFGRDA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgatcttcggcattcccctgcaggcgttgctcggccagctgctgatcggcctg
atcaacggctcgttctacgcgctgctcagcctcggcctcgccatcattttcggcctgctc
agggtgatcaacttcgcccatggcgcgcaatatatgctcggcgccttcgtcgcctatctg
ctgctcacctatgccggcatcggctactggccgtcgctgatcctggcgcccgtcatcgtc
ggtcttggcggtgcgatcatcgagcggctgttcctgcgccggctctacgacctcgatccg
ctctacggcctgctcttcaccttcgggctggcgctggcagtcgaaggcaccttccgctat
ctctacggctcctccggccagccctatgcgacgccggccgcactggcaggcggcgccaat
ctcggcttcatgttcctgccgatttatcgcggctgggtggtggtcgtctcgctggtcgtc
tgcctcggcacatggctgctgatcgagaagaccaaactcggcgcctatctccgggccgcg
accgaaaacgctgtgctggtgcaggtcttcggggtcaacgtgccggtgctgctgacgctg
acctacgcgctcggcgccggtcttgccgcctttgccggcgtgctggcggcgccgatctac
caggtctcgccgctgatgggctcgaacatgatcatcgtcgtcttcgccgtggtggtcgtc
ggcggcatgggatcgatcatgggcgcgatcatcaccggttatgtgctcggcatcgccgag
ggcctgaccaaggtcttctatcccgaggcctctaacatcgtgatcttcgtcatcatggcg
atcgtgcttctcatcaggcccgcgggcctcttcggccgggacgcttga

DBGET integrated database retrieval system