KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5827Help
Entry
Rleg2_5827        CDS       T00779                                 

Definition
(GenBank) hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4623
Motif
Other DBs
NCBI-ProteinID: ACI59000
UniProt: B6A3L7
Position
pRLG202:238255..238494
Genome map
AA seq 79 aa AA seqDB search
MVSRNIPHEYFLLNTARAEGPVVGRLHGKAISASVVDRNGRRYLFVGVAARDRWGRLDVL
SLRRGEWIVAPDLIYAEAT
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggtaagccggaatatcccgcacgaatattttctgctcaatacggcaagggcggaaggc
cccgtggtcggtcgtcttcacggcaaagcgatctccgcttccgtcgtcgaccgcaacggc
cgccgctacctcttcgtcggggtcgcggccagggatcgctggggcagacttgatgtcctg
tcgctgagacgcggcgagtggattgtcgcacccgaccttatctacgcagaggccacctga

DBGET integrated database retrieval system