KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_6208
Entry
Rleg2_6208        CDS       T00779                                 

Definition
(GenBank) conjugal transfer protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB
Other DBs
NCBI-ProteinID: ACI59584
UniProt: B6A5A1
Position
pRLG203:151458..152249
AA seq 263 aa
MKTFIIAAALGIIAASHAYAQVPVRDSENISLSEEIKRLSSQIQQDTSVVKDNTTKTLQA
ITGDRTQDASQFAKLATGNGFSMGQAPDFNSILSGNQAVFGGIGGQFQNTAAKLINGLNL
VKMVADTVKGGELSGANQAYSQGINALTTMTALTDAMNSATKDRQNSFMQATQQVGTAQD
LKGALEQNTQMVLQGNQTANEAVGSLNNQVMLLNQQYKAALATSSQNLKTFATLPDSVMR
DDGAGQQGVSVRDQLKAFEEQSQ
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaagacattcattatcgcggcggctctaggcatcatcgccgcctcgcacgcttacgcg
caggtgccggtcagggactcggagaacatatctctgagcgaggagatcaagcggctatcg
tcgcagatccagcaggacacgtcagtcgtcaaggacaatacgacgaagacgctgcaggcg
atcaccggcgatcgcacccaggatgccagccagtttgccaagcttgcgactggcaacggt
ttcagcatggggcaggcgccggatttcaacagcatcttgtccggcaaccaagctgtgttc
ggcggaatcggcggccagttccagaatacggccgccaagctgatcaatggcctgaacctg
gtgaagatggtcgccgacacggtcaaggggggcgagctctccggtgccaaccaggcttat
tcgcaaggcataaacgcgttgacgaccatgacggcgctcaccgatgcgatgaacagcgcc
accaaggatagacagaactccttcatgcaggcgacacagcaggtcggcaccgcgcaggat
ctgaagggagcgctcgagcagaacacccagatggtgctgcagggcaaccagaccgccaac
gaggccgtcggctcgctcaacaatcaggtcatgctgttgaaccagcaatacaaggccgcg
ctcgcgacgtcgtctcagaacctcaagaccttcgcgacacttcctgacagcgtcatgcgt
gatgacggtgccggtcagcaaggtgtctccgtgcgggatcaactgaaggcgttcgaggag
cagtcacagtga

DBGET integrated database retrieval system