KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_07250Help
Entry
RLEG12_07250      CDS       T03015                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00520  Amino sugar and nucleotide sugar metabolism
rlu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RLEG12_07250
Enzymes [BR:rlu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     RLEG12_07250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-ProteinID: AHG48721
Position
unnamed:731848..732870
Genome map
AA seq 340 aa AA seqDB search
MVTGGTGFLGSFLCERLLREGNDVLCVDNYYTGSRDNVLHLLDDPRFEILRHDITFPLYV
EVDEIYNLACPASPVHYQHDPVQTVKTNVHGAINMLGLAKRTKAKIFQASTSEVYGDPAV
HPQPEDYRGSVNPIGPRACYDEGKRCAETLFFDYHRQYGVEIRVARIFNTYGPRMQTNDG
RVVSNFIVQALRNEPITIFGNGTQTRSFCYVDDLIEGFIRLMGTPAGVTGPINLGNPGEF
QVRELAEMVVEMTGSKSGIVYKPLPIDDPTQRKPNISRAMQELGWQPTVSLREGLERTIA
YFEWKLAGGVRNILGAKSPQEAYPDLLPAKVGLPVAEITR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggttaccggcggcaccgggtttctgggatcattcctgtgcgaaaggcttttacgggag
ggcaatgacgtcctctgcgtggacaattactacaccggttcgcgcgacaatgtgctgcac
cttctcgacgacccacgctttgagattcttcgccacgacattaccttcccgctttatgta
gaggtcgacgagatctacaacctcgcctgcccggcatctccggtccactatcagcacgac
cccgtgcaaacggtgaagacgaacgtgcacggggccatcaatatgcttggccttgccaaa
cgcaccaaggcgaagatcttccaggcctccaccagcgaagtttatggtgatccggcagtt
caccctcaacccgaggactatcgaggcagcgtcaatcccattggcccgcgggcatgttat
gacgaaggcaagcggtgtgccgaaacattgttcttcgactatcatcgtcagtatggcgtg
gaaatccgggtagcgcggatattcaatacttacgggccgcgcatgcagaccaatgacggc
cgcgtcgtctccaatttcatcgtccaggcgctccgaaacgagccgatcaccatcttcggc
aacggcacgcaaacgcgctccttctgctacgtagacgatctcatcgagggtttcatccgc
ctgatgggtacgccggccggcgtcacgggtccgatcaatctcggcaacccgggagaattc
caggtccgggaactggccgaaatggtcgtcgaaatgaccgggtctaaatcaggcatcgtt
tacaagcctctgccgattgacgatccgacacagcgcaagcccaatatcagccgtgcaatg
caggaattgggctggcagccgacagtgagcctgcgtgaagggctcgagaggacgattgcc
tattttgagtggaagcttgccggcggcgtcaggaacattctcggcgccaagtcgccgcag
gaggcttacccggatctgcttcctgcgaaggtcggccttcctgtcgcggaaatcacacga
tag

DBGET integrated database retrieval system