KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_09800Help
Entry
RLEG12_09800      CDS       T03015                                 

Definition
(GenBank) dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00361  Chlorocyclohexane and chlorobenzene degradation
rlu00625  Chloroalkane and chloroalkene degradation
rlu01100  Metabolic pathways
rlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RLEG12_09800
   00361 Chlorocyclohexane and chlorobenzene degradation
    RLEG12_09800
Enzymes [BR:rlu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     RLEG12_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase DUF356 HAD
Motif
Other DBs
NCBI-ProteinID: AHG49227
Position
unnamed:1238107..1238772
Genome map
AA seq 221 aa AA seqDB search
MTFDCYGTLTNFDMAGAARRVYSERLSPEAMAAFVEAFRGYRLDEVLGPWKPFVEVVHNS
IERSCKRIGIPFKPEDAQRIYDEVPTWGPHPDVPVGLSKVAKEIPLVILSNSMNSLIMSN
VEKLGAPVHMVITAEEVGAYKPLMKGFEYMLDKLGCGPEDITHVSSSFRYDLMTAYDLGI
KSKVWVNRGHEPANPFYEYTEIKDIGGLAAAVGLEPALKRA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcgactgctacggcacgctcaccaatttcgacatggccggcgcggcgcgacgc
gtctacagcgagcgcctctcccctgaagcgatggcagccttcgtcgaggctttcaggggc
tatcgccttgacgaggtgctaggcccatggaaaccgttcgtcgaagtggtgcacaattcg
atcgaacgcagctgcaaacgcatcggtatcccgttcaaacccgaagacgcgcaacgcatc
tatgacgaggtgccaacctggggtccgcacccggacgtcccggttggcctgtccaaagtg
gccaaggaaatcccgctggtcatcctgtcgaactccatgaacagcctgatcatgtcgaac
gtggaaaagttgggcgcacccgtccatatggtaatcacggcagaagaagtcggggcatac
aaacctctgatgaagggcttcgaatacatgctcgacaagctcggctgcggaccggaagac
atcactcatgtgtcctcatcattccgctacgacctgatgaccgcctatgacctgggcatc
aagagcaaggtctgggtcaaccgcggtcatgagccggccaatcccttttacgaatacacc
gagatcaaggatatcggtgggctagccgccgccgttggcctggagccagccctcaagcgc
gcctga

DBGET integrated database retrieval system