KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_12395Help
Entry
RLEG12_12395      CDS       T03015                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00071  Fatty acid degradation
rlu00072  Synthesis and degradation of ketone bodies
rlu00280  Valine, leucine and isoleucine degradation
rlu00310  Lysine degradation
rlu00362  Benzoate degradation
rlu00380  Tryptophan metabolism
rlu00620  Pyruvate metabolism
rlu00630  Glyoxylate and dicarboxylate metabolism
rlu00640  Propanoate metabolism
rlu00650  Butanoate metabolism
rlu00900  Terpenoid backbone biosynthesis
rlu01100  Metabolic pathways
rlu01110  Biosynthesis of secondary metabolites
rlu01120  Microbial metabolism in diverse environments
rlu01130  Biosynthesis of antibiotics
rlu01200  Carbon metabolism
rlu01212  Fatty acid metabolism
rlu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLEG12_12395
   00630 Glyoxylate and dicarboxylate metabolism
    RLEG12_12395
   00640 Propanoate metabolism
    RLEG12_12395
   00650 Butanoate metabolism
    RLEG12_12395
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RLEG12_12395
   00072 Synthesis and degradation of ketone bodies
    RLEG12_12395
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLEG12_12395
   00310 Lysine degradation
    RLEG12_12395
   00380 Tryptophan metabolism
    RLEG12_12395
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RLEG12_12395
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RLEG12_12395
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RLEG12_12395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rlu04147]
    RLEG12_12395
Enzymes [BR:rlu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RLEG12_12395
Exosome [BR:rlu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RLEG12_12395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG43974
Position
208541..209749
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGLDTNTVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAGKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSRTDVDAYAVESQKRAAHA
WEQGWFDKSVVPVKDQNGLTILATDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAGAVLLGSKAGGESMGLKPRARIKAFANIGSDPALMLT
GPVDVTEKLLKRTGMSLTDIDLFELNEAFAAVVLRYMQAFDIDHDRINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggttttcatttacgatcacgtccgcacgccgcgtggccgcggcaagaaggac
ggcgccctgcatgaggtgccctccgtgcgcctcgcggccaagacgctggaggcgatccgc
gaccgcaacgggctcgacaccaacaccgtcgacgacatcatcatgggctgcgtcgatccg
gtcatggatgccggcgccgtgattcccaaggcagccgccttcgaagccggctactccacc
agggcgcccggcatgcagatctcccgcttctgcgcctcgggcctcgacgccgtcaatttc
ggcgccggcaagatcgcccagggggccgacgacatcgtcatcgcgggcggggtggaaagc
atgtcccgcgtcggcttgggcatgtcgggcggcgcctggttcatggacccttcggtaaat
ttcccggcctatttcatgccgcagggcgtctcggccgatctcatcgccaccaaatacggc
ttcagccggaccgatgtcgacgcctacgccgtcgagagccagaagcgcgccgcccatgcc
tgggaacagggctggttcgacaagtcggtcgtcccggtcaaggaccagaatggcctgacg
atcctggcaaccgacgagcacatgcgccccggcaccgacatgcaggcgctcgcctcgctc
aatccgtccttccagatgcccggcgagatgggcggcttcgaggccgtcggcatccaggcc
catccggagatcgagcgcatcaactatgtccaccatgccggcaactcctccggcatcgtc
gacggcgccggcgccgtcctgctcggctccaaggccggcggtgaaagcatggggctcaag
ccgcgcgcccgcatcaaggctttcgccaatatcggctccgatccagccctgatgctgacc
gggccggtcgacgtcaccgagaagctgttgaaacggaccggcatgagccttacggacatc
gacctcttcgaactgaacgaggccttcgctgccgtggtgctgcgttacatgcaagccttc
gacatcgaccacgacaggatcaacgtcaatggcggcgccatcgccatgggtcatccgctc
ggcgccaccggcgcgatgatcctcggcaccgtgctcgacgaactcgaacgccgcgacctc
aacaccgcgctggtgacgctctgcatcggtgccggcatgggcacggcaacggttatcgaa
agggtctga

DBGET integrated database retrieval system