KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_17350Help
Entry
RLEG12_17350      CDS       T03015                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00480  Glutathione metabolism
rlu00590  Arachidonic acid metabolism
rlu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RLEG12_17350 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RLEG12_17350 (btuE)
Enzymes [BR:rlu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RLEG12_17350 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AHG44897
Position
1207013..1207561
Genome map
AA seq 182 aa AA seqDB search
MTGNVLDIPVKTVDGRDTTLNDYKGRVLLVVNVASKCGLTPQYEGLEKLYVEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVATTG
DGPMRERLKSHGISGGDEGDILWNFEKFLIGRDGKVAARFAPDVTADDSRLVSAVDKELA
KG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcaatgtgctggatatcccggtcaagactgtggatggtcgtgacaccacgctc
aacgactataagggcagggtgctgctggtcgtcaatgtcgcctcgaaatgcgggctcacg
ccgcagtatgaaggcctggaaaaactctatgtcgaaaagcgcgagcgcggcttcgtcatc
gccgctttccccgccaacgacttcaagggccaggaacccggcaccgacgccgagatcctc
gatttctgcaccagcacctacgacgtcaccttcccgatcttctcgaagatctcggtcaag
ggcgaagcccagcacccgctttaccgccaattgaccaaatcgggtgtggcgacaacaggc
gacggcccgatgcgcgaacgcctgaaatcccacggcatatccggcggcgacgagggcgac
atcctctggaacttcgaaaaattcctgatcggccgcgacggcaaggtcgccgctcgattc
gcgcctgacgtgacggcggatgattcgcggctggtttcggcggtggataaggaactggcg
aagggatga

DBGET integrated database retrieval system