KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_18155Help
Entry
RLEG12_18155      CDS       T03015                                 

Definition
(GenBank) glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00350  Tyrosine metabolism
rlu00643  Styrene degradation
rlu01100  Metabolic pathways
rlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RLEG12_18155
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    RLEG12_18155
Enzymes [BR:rlu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     RLEG12_18155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AHG45047
Position
1358702..1359334
Genome map
AA seq 210 aa AA seqDB search
MNEVVLYDYWRSSASYRVRIALNLLGLDYRTVPINLLDGAHRMPDYLALNPQGLVPTLVI
DGKTLTQSLAIIEYLAELHPECRLLPSDSADRQKVRALAYAIAMDIHPICNLHVVSHLMT
LTEKADAREEWMKHFIGDGLRRVEAMIGEADGKFSFGDRPAMADLCLVPQLYNARRWGVD
MTAFSRITDIDARCAELPAFQAAHPDRVKP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtggttctctacgactactggcgatcgtcggcgagctaccgcgtccgcatc
gcgctcaacctgctgggtctcgactatcggaccgtgccgatcaacctgttggacggcgcg
caccggatgccggactatctcgcgctcaacccgcaagggctcgtgccgacattggtgatc
gatgggaaaacactgacgcagtcgcttgccattatcgaatatcttgccgagcttcacccg
gaatgtcgattgctgccatccgatagcgccgatcgccagaaggtgcgcgccctcgcatac
gcgatcgccatggacatccatccgatctgcaacctgcatgtcgtctcgcatctcatgacg
ctgacggaaaaggccgatgcccgcgaggaatggatgaagcatttcattggcgacgggctt
cgccgagtggaggccatgatcggcgaggccgatggaaagttcagctttggcgacaggcct
gcgatggccgacctctgccttgttccccagctctacaatgcgcgccgctggggcgtggat
atgaccgctttcagccgcatcaccgacatcgacgccagatgcgccgaactgccggccttc
caggcggcgcatcccgaccgcgtgaaaccgtag

DBGET integrated database retrieval system