KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_27375Help
Entry
RLEG12_27375      CDS       T03015                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00430  Taurine and hypotaurine metabolism
rlu00620  Pyruvate metabolism
rlu00640  Propanoate metabolism
rlu00680  Methane metabolism
rlu01100  Metabolic pathways
rlu01120  Microbial metabolism in diverse environments
rlu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLEG12_27375
   00640 Propanoate metabolism
    RLEG12_27375
  09102 Energy metabolism
   00680 Methane metabolism
    RLEG12_27375
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RLEG12_27375
Enzymes [BR:rlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     RLEG12_27375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AHG46729
Position
3169106..3170284
Genome map
AA seq 392 aa AA seqDB search
MSSTDLLLTFNAGSSTVKIGIFAIDGGKARRIGKGVIDLRAEPLSLCLSRGSQAFDVPLK
TSITEDLRSVIDESLALLADHFDVAATRAAGHRVVHGGDRFTSAIALDDAAIDAVDALTP
LAPLHQPQALRFIRALRHLKPRLAQTASFDTAFHATQDDLVRRFAIPRALHEEGVKRYGF
HGLSYKFIAGELARKAPRAAKAVVAHLGSGASLCALDQGVSRDCSMGFSTLDGIPMATRP
GWLDPGVILHLAGERKQSFTEIEDLLYHRSGLLGLSGISADTRDLLKDGRPEARQAIDFF
TLRIAGEIGRMAVTLRGLDAVVFTAGIGEHQSEIRAGVAKRLSWLGLAIDEKANSANEFM
ISTGESRIAAHVIATDEEQIIADEALSLLGSG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgaccgacctcctgctgactttcaacgccggctcctcgaccgtcaagatcggc
atcttcgccatcgatggcggcaaggcgcggcgcatcggcaagggcgtgatcgatttgcgc
gccgaaccgctctcgctctgtctgagccggggatcgcaggcattcgacgtacctttgaaa
accagcataacggaagatctgcgcagcgtgatcgacgagagcttagcgcttcttgccgat
catttcgacgtcgccgccacccgcgccgccggtcaccgcgtcgtccatggcggcgatcgt
ttcaccagcgcgatcgccctcgacgatgccgcgatcgatgccgtcgacgcgctgacgcca
cttgcgcccctgcatcagccgcaggcgttgcgtttcatccgcgcgctgcgccatctgaaa
ccgcgtcttgcccagaccgcctccttcgacacagccttccatgccacccaggacgatctc
gttcgccgcttcgccattccccgtgcactgcatgaggaaggcgtcaagcgctacggcttt
catggcctttcctataaattcatcgccggtgagctcgcccgcaaggcgccgcgcgcggca
aaggcggtggttgcccacctcggcagcggcgccagcctctgcgcgctcgaccaaggcgtc
agccgcgattgcagcatgggcttttcgacgctcgacggcatcccgatggcgacgcgcccg
ggctggctcgatcccggcgtcattctgcatctggcgggagagaggaagcaatccttcacg
gaaatcgaagacctgctctatcaccgctccggcctgctcggcctatcgggcatcagtgcc
gatacacgcgaccttttgaaggacggacggccggaggcgcgccaggcgatcgatttcttc
acactgcgcattgccggcgaaatcggccgtatggcggtaacgcttcgcggccttgacgcc
gtcgtcttcactgccggcatcggcgagcatcaatcggagatccgtgccggcgtggccaag
cggctctcctggcttggccttgcgatcgacgaaaaggccaattccgccaatgagttcatg
atcagtacaggggaaagccgcatcgccgcccatgtcatcgccaccgatgaggagcagatc
atcgccgacgaggcgctgtcccttcttggcagtggctga

DBGET integrated database retrieval system