KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_28010Help
Entry
RLEG12_28010      CDS       T03015                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00260  Glycine, serine and threonine metabolism
rlu01100  Metabolic pathways
rlu01110  Biosynthesis of secondary metabolites
rlu01120  Microbial metabolism in diverse environments
rlu01130  Biosynthesis of antibiotics
rlu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RLEG12_28010
Enzymes [BR:rlu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RLEG12_28010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHG46852
Position
3297496..3298548
Genome map
AA seq 350 aa AA seqDB search
MFFASDNWAGAHRSIAERLLAESAGYAPAYGAGDLDKKVETRFCEIFEREVSVFFVATGT
AANSLSLASVQRPGGITFCHTESHVIEDECGAPEFFSGSARLMAIDGEAGKIDPAGLSKK
IANFPEDALRHGRASAVTITQATEIGTVYSLPEIGEIAAISRKRNLPLHMDGARFANALI
ALGATPAEMTWKRGVDMLSFGGTKNGCWCAEAIVFFNPDQAREMPFIRKRAAQLFSKSRF
IAAQFDAYFENGLWLDLARHSNAMADRLRAGIAASSAGRLAWRTASNEVFAVISKSAAKT
AEEKGAKFYEWPAPAAAPELVSESENLIRLVTSFATTEADVDGFLKCLAA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcttccgataactgggccggcgcccacagatccattgccgaacgtctgctg
gcggaatcggccggctatgctcctgcctatggcgccggcgatctcgacaagaaggtcgaa
acccgcttctgcgagatcttcgaacgtgaggtttcggttttcttcgtcgccaccggcacg
gccgccaattccctgtcgctggcaagcgtccagcgcccgggcggcattaccttctgccat
accgagtcgcatgtgatcgaagatgaatgcggggcgccggaattcttctccggctccgcc
aggctcatggcgatcgacggcgaagccggcaagatcgatccggccgggctttccaaaaaa
atcgcaaactttccggaggacgctctccgccatggccgcgccagcgccgtgaccatcacc
caggcaacggaaatcggcacggtctattccctgccggagatcggcgaaatcgccgccata
tcgaggaagcgcaacctgccgcttcacatggatggcgcccgcttcgccaatgcactgatt
gcgctcggcgccaccccggccgaaatgacctggaaacgcggcgtcgacatgctctccttc
ggcggcaccaagaacggctgctggtgcgcggaagcgatcgtcttcttcaatccggatcag
gcaagggaaatgcccttcatccgcaagcgcgccgcccagctcttctccaagtcacgtttc
atcgcagcccagttcgacgcctatttcgaaaacggcctctggctcgacctcgcacgccat
tcgaacgccatggccgaccggctgcgcgccggtattgccgccagcagcgccgggcgcctc
gcctggcggaccgcttccaacgaggtctttgccgtcatcagcaagagtgctgcgaaaacc
gcagaggaaaaaggtgcgaaattttatgaatggccggcgcctgcggcagcgccggaactc
gtttccgaaagcgagaacctgatccgcctcgtcaccagcttcgcaacgacggaagccgat
gtggatgggttcctgaagtgcctggccgcctga

DBGET integrated database retrieval system