KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_29075Help
Entry
RLEG12_29075      CDS       T03015                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RLEG12_29075
Enzymes [BR:rlu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     RLEG12_29075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHG47055
Position
complement(3535552..3536424)
Genome map
AA seq 290 aa AA seqDB search
MSFKAAAIQMCSGVDPVKNAVAMARLVREAAAQGATYVQTPEMTGMLQRDRTAARAVLAD
EAHDIIVKTGSELAAEFGIHMHVGSTAIALADGKIANRGFLFGPDGKILNRYDKIHMFDV
DLDNGESWRESAAYTAGSEARVLSLPFAEMGFAICYDVRFPALFRAQAIAGAEVMTVPAA
FTRQTGEAHWEILLRARAIENGVFVVAAAQAGRDEDGRHEDGRETFGHSMIIDPWGTVLA
SAGATGEAVIVAEIDPGAVKAAHDKIPNLRNGREFSIEKIAGAVAGGVAA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaggccgccgccatccagatgtgctccggggtcgatccggtgaagaatgcc
gtcgccatggcgcgactggtgcgcgaggccgccgcccaaggcgcaacctatgtgcaaacg
cccgagatgaccggcatgttgcagcgcgatcgcaccgcggcgcgcgccgtgctcgccgat
gaggcccatgacatcatcgtcaaaaccggctccgagctcgcggccgaattcggcattcac
atgcatgtcggctcgaccgcgatcgccctcgccgacggcaagatcgccaatcgcggtttc
ctgttcggtcccgacggcaaaatcctcaatcgctacgacaagatccatatgttcgacgtt
gacctcgacaatggcgagagctggcgcgaaagtgccgcctatacggccggctcggaggcg
cgcgtgctgtcgttgccctttgccgaaatgggtttcgccatctgctacgatgtgcgcttt
cccgcactcttccgcgcccaggcgattgccggcgccgaggtgatgacggttccggccgcc
ttcaccaggcagaccggtgaggcgcattgggagatcctgctgcgtgcacgcgcgatcgag
aacggtgtcttcgtcgttgccgcggcgcaggccggccgggacgaagacgggcggcacgag
gacggccgggagaccttcggccattcgatgatcatcgacccttggggcaccgtgctggcc
tcggccggcgccaccggcgaggcggtaatcgtcgcggagatcgatcccggcgcggtcaag
gctgcgcatgacaagatccccaacctgaggaatggccgggaattttcgatcgagaagatt
gctggggcagtcgccggaggcgtggccgcttga

DBGET integrated database retrieval system