KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0548Help
Entry
Rmag_0548         CDS       T00438                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Brite
KEGG Orthology (KO) [BR:rma00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Rmag_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABL02300
UniProt: A1AWJ3
Position
600824..601195
Genome map
AA seq 123 aa AA seqDB search
MKNNIEIEVKVTYLEHQSDVYASQYSYAYTITIINKGNVGVQLLTRHWRIQDETGYIEDV
IGEGVIGQQPHLASGESFQYASGAIIKTLTGSMKGSYGMVDDYGERFNVQIPEFVLSKPY
TLH
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaacattgaaatagaggttaaagtgacttatttggagcatcagtctgatgtt
tatgcaagtcagtactcctatgcttacaccattacaattattaacaagggcaatgttggc
gtgcaacttttaacacgtcattggcgtattcaagatgaaactggatatattgaagatgtt
attggcgaaggtgtgattggtcaacagcctcatttggcgtcaggagaatcttttcagtac
gcctcaggtgctattatcaaaaccttaactggttccatgaaaggctcttatggtatggtt
gatgactatggcgagcgttttaatgtgcaaattcctgaatttgtgctcagcaaaccttat
acgctacattaa

DBGET integrated database retrieval system