KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0570Help
Entry
Rmag_0570         CDS       T00438                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00450  Selenocompound metabolism
rma00970  Aminoacyl-tRNA biosynthesis
rma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rmag_0570
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rmag_0570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rma01007]
    Rmag_0570
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rma03016]
    Rmag_0570
Enzymes [BR:rma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Rmag_0570
Amino acid related enzymes [BR:rma01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Rmag_0570
Transfer RNA biogenesis [BR:rma03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rmag_0570
 Prokaryotic type
   Other AARSs
    Rmag_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABL02321
UniProt: A1AWL4
Position
complement(621606..623258)
Genome map
AA seq 550 aa AA seqDB search
MTSRKILVTSALPYANGEIHLGHLLEYIQADIWVRFQKMMGNECYYVCADDTHGTPIMLK
SDELGITPETLIKGVSERHQADFKEFSIGFSKYHSTHSQENKDISANIYHKLNDAGFIKT
RIISQAFDPEKQMFLPDRFIKGDCPKCGANDQYGDNCEICGVTYSPTELKNAKSIISDAT
PIAKDSEHYFFDLPQFETQLKAWIKEGHLQDEVSNKLSEWFEQGLQQWDISRDAPYFGFQ
IPDVEGKYFYVWLDAPIGYMASFKKLCDEQGLDFDEYFNKDSNTELYHFIGKDIVYFHAL
FWPAILMGSNYRTPSAIFVHGFLTVNGQKMSKSRGTFIQARTYLNHLNPECLRYYYAYKL
SAKIDDIDLNLTDFKQRVNSDLVGKVVNIASRSTGFLVKKFNKTLSDYAIDPELYHEFVA
CGDIIKKHYEARNYNQAMREIMKLADKANQYIDEHKPWQLVKKDTKQVHDVTSLAINLFR
VLMTYLKPVLPVMAKQAEMFLNIDAFNWQDLKRPLTKHQINTFKPLMSRIEDEKIEQVIE
ASKQNMQVVA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcgaaaaattctcgttacctcagcattgccttatgctaatggtgaaattcat
ttggggcatttattggaatacattcaagctgatatttgggtgcgttttcaaaaaatgatg
ggtaatgagtgttattatgtttgtgctgatgatacacatggcacgcccattatgcttaag
tctgatgagcttggtattactcctgagacgttaattaagggtgtgagtgaacgccatcaa
gcagattttaaagaattttcaataggttttagcaaatatcactcaactcatagtcaggaa
aataaagacatttctgctaatatttatcacaagttaaatgatgctggttttattaaaaca
cgtatcatttctcaggcgtttgatcctgaaaaacagatgtttttacccgatcgcttcatt
aaaggtgattgtcctaaatgtggtgctaatgaccaatatggtgataattgtgaaatttgt
ggggtaacctattcgccaacagaactaaaaaatgccaaatctattatttcagatgcaact
ccaatcgctaaagactcggaacactatttctttgacttgcctcaatttgaaacgcaactt
aaagcgtggatcaaagaagggcatttacaagatgaagttagcaacaaattatctgagtgg
tttgaacaaggccttcaacaatgggatatttctcgtgatgcgccgtattttggttttcaa
attcctgatgtggaaggcaagtatttctatgtttggctagatgcaccgattggctatatg
gcaagttttaaaaagctttgtgatgaacagggtttggatttcgatgaatactttaataaa
gactcaaatacagagctttatcattttatcggtaaagacattgtttatttccatgcactt
ttttggccggctatattgatgggctcgaattatcgtacgccaagtgcaatctttgtacat
ggatttttaaccgtgaacggacaaaaaatgagcaaatctcgtggcacatttattcaggct
agaacttatcttaatcatcttaatcctgaatgtttgcgttattattacgcctataaactg
tctgctaaaattgacgatatagatcttaatttgactgattttaaacaacgtgtaaattca
gacctagtaggtaaagtggttaatattgcttcacgtagtacgggatttcttgttaagaaa
tttaacaaaactttatctgattatgctattgatcctgagctttatcatgaatttgttgct
tgtggtgatatcattaaaaaacactatgaagcgcgtaattataatcaagctatgcgtgag
attatgaaattagccgataaagctaatcaatatatcgatgagcataagccatggcaactg
gtaaaaaaagatactaaacaagtgcatgacgtgacttcacttgctattaatttatttaga
gtgttaatgacttatcttaaaccagtattgcctgttatggcaaaacaagctgagatgttt
ttaaatatagatgcgttcaattggcaggatttaaaacgtcctttaaccaagcatcaaatt
aatacattcaaacctttaatgtcacgtattgaagatgaaaaaattgagcaagttattgaa
gcttcaaaacaaaacatgcaagtagttgcgtag

DBGET integrated database retrieval system