KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0840Help
Entry
Rmag_0840         CDS       T00438                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00670  One carbon pool by folate
rma01100  Metabolic pathways
rma01120  Microbial metabolism in diverse environments
rma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rmag_0840
Enzymes [BR:rma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Rmag_0840
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Rmag_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH NAD_binding_7 adh_short OCD_Mu_crystall DUF2325
Motif
Other DBs
NCBI-ProteinID: ABL02557
UniProt: A1AXA0
Position
complement(898730..899563)
Genome map
AA seq 277 aa AA seqDB search
MNIIDGKQIAQNLRANIKLKVDALDRKPGLAVILVGDDEASEVYVRNKDNACKEVGFYSK
KINKPINTTQAELLSEIECLNNSDKIDGILVQLPLPKHLDANLVIEAISPKKDIDGFHSE
NIGKLMQNKPFLRPCTSKGVMMIFEMIGVNLVGKNCVVVGASNIVGRPMACELLNAQATV
TICNSKTKNLSNKLKQADIVVVAVGIAQMIQKDWIKPGSIVIDAGINRLDNNQLVGDVDF
ESVMQVASWITPVPGGVGPMTIAALLENTLIAYEGKI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaatattattgacggcaaacaaattgcacagaatttacgagcaaatattaaattaaaa
gttgatgcgcttgatagaaaaccaggactagcagttattttagttggtgatgatgaggcc
tcagaagtttatgttcgtaataaagataatgcttgtaaagaagtgggtttttattcaaaa
aaaattaacaaacctatcaataccactcaagcagaattattatctgaaattgagtgtttg
aataatagtgataaaattgatggcattttagtgcaattaccccttccaaagcatttagat
gccaatttagtgattgaagcaatctcacctaaaaaggatatagatggttttcatagtgaa
aatattggtaaattgatgcaaaataaaccttttttacgcccatgtacgtctaagggcgtg
atgatgatatttgaaatgattggagtgaatttagtgggtaaaaattgtgtggtggtgggt
gcgtctaatattgttggtcgtccaatggcgtgtgagttgttaaatgctcaagcaacggtt
actatttgtaatagcaagactaaaaatctttctaacaaattaaaacaagcagatattgtt
gtcgttgcagttggtattgctcagatgattcaaaaagactggataaaaccaggctctatt
gtgattgacgctgggattaatcgattggataataatcaattggttggagatgttgatttt
gagtctgttatgcaggttgctagctggattactccagtaccaggtggtgttggaccaatg
accattgctgcattattagaaaatacattaatcgcatatgagggaaaaatatga

DBGET integrated database retrieval system